حل واجب 00966562053739 حلول واجبات الجامعه العربيه المفتوحة

إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة واتس 00966562053739 بعد سنوات من الخبرة في كتابة البحوث الجامعية و بحوث التخرج و تقارير كثيرة و اسايمنتات و بروجكتات و بدون نسبة اقتباس نقوم بإنجاز بحثك الجامعي من الألف إلى الياء , من صفحة الغلاف حتى نهاية صفحة المصادر تواصل معنا على الواتساب لنقدم لك خدمة كتابة بحوث جامعية بدون نسبة اقتباس ! نقوم بفحص نسبة التشابه على برنامج ال Turnitin لتتأكد أن بحثك خالي من النسخ واللصق ! نكتب بلغتين عربي و انجليزي حلول واجبات الجامعة العربية المفتوحة واتس 00966562053739 واتساب: نماذج من اعمال اقتصاد محاسبة مالية موارد بشرية تسويق HRM marketing human resources strategy strategic management operation management buالسابقة واتساب 00966562053739 بعد سنوات من الخبرة في كتابة البحوث الجامعية و بحوث التخرج و تقارير كثيرة و اسايمنتات و بروجكتات و بدون نسبة اقتباس نقوم بإنجاز بحثك الجامعي من الألف إلى الياء , من صفحة الغلاف حتى نهاية صفحة المصادر تواصل معنا على الواتساب لنقدم لك خدمة كتابة بحوث جامعية بدون نسبة اقتباس ! نقوم بفحص نسبة التشابه على برنامج ال Turnitin لتتأكد أن بحثك خالي من النسخ واللصق ! نكتب بلغتين عربي و انجليزي أيضاً نقدم حلول ممتازة لواجبات الجامعة العربية المفتوحة واتس 00966562053739 بعيدا عن النسخ او التشابه وقد حملنا تلك المسئولية على عاتقنا واصبحنا متميزون بالوصول لأعلى الدرجات في جميع الواجبات الخاصة بطلاب الجامعة العربية المفتوحة. Arab open university assignments tma aou . وقد قمنا بخدمة جميع الطلاب في الجامعة العربية المفتوحة بجميع فروعها في الكويت البحرين سلطنة عمان الاردن لبنان السعودية الرياض الدمام جدة حائل الاحساء المدينة المنورة حل واجب tu170 gr101 gr111 gr131 gr115 حل واجبات ادارة اعمال بكالوريوس ابتعاث ماجستير ماستر واتس 00966597837185 Lb170 lb160 sys210 sys280 Sys380 bus310 bus115 B629 b628 b326 B325 B123 b324 be210 be200 be201 b205a b205b b203b b203a b207a b207b b301a b301b t205a t205b t306a t306b b291 b292 b293 mba master assignments b716a b716b bb835 b121 b122 B123 b124 A00966562053739

إعداد رسائل ماجستير إدارة الأعمال واتس 00966562053739 حلول اسايمنتات إدارة أعمال Mba كتابة بحوث تخرج ماستر ابحاث جامعية الماجستير حل اسايمنت Mba master assignments research proposal plan graduation project master thesis dissertation diploma business management administration leadership human resources supply chain إعداد رسالة ماجستير mba عمل رسائل وابحاث تخرج Mba master assignments business management administration leadership حل واجبات cipd حلول اسايمنتات إدارة أعمال Mba master assignments حل واجبات Mba الامارات الكويت البحرين سلطنة عمان الاردن لبنان واتساب 00966562053739 كتابة ابحاث جامعية 00966562053739 في سلطنة عمان لطلاب الجامعات , كتابة بحوث تخرج 00966562053739 وفر وقتك ودعنا نقوم بالكتابة نيابة عنك لدينا فريق متكامل ومتدرب ومؤهل نقوم ب كتابة البحوث و التقارير الجامعية و عمل البوربوينت و الواجبات و الكيس ستدي باللغتين بالعربي و الانجليزي و نقوم بعمل و كتابة ابحاث التخرج و نقوم كذلك بالترجمة الكتابة لا يكون بها نسخ , ونقوم بفحصها لك ولدينا ميزة التعديل مجاناً بعد تسليمك طلبك , و إن كانت التعديلات متناقضة مع التعليمات الاولية يتم اضافة رسوم بسيطة جداً للتعديل. MBA . CIPD . SHRM . PMP and other courses المساعدة في حل واجبات الموارد البشرية وكتابة رسالة الماجستير حل واجب CIPD شهادة ادارة وتنمية الموارد البشرية و عمل بحوث تخرج ماجستير كتابة ابحاث ادارة اعمال ماجستير/ ماستر mba حلول واجبات business management معهد / دبلوم / ماستر / كلية / جامعة بالغه الانجليزيه GET EASY WRITING HELP WITH EXPERTS كتابة بحوث باللغه الانجليزيه : ماستر موارد بشرية إدارة اعمال بحوث تخرج بإحترافيه عالية وسرعة التنفيذ الخدمات كتابة ابحاث كتابة ابحاث التخرج ورسالة الماجستير handling assignment حل واجبات الموارد البشريه والمحاسبة والتمويل والتسويق مهتم في العمل مع CIPD -MBA نساعد في اختبارات CIPD وماستر اداراة الاعمال كتابة ابحاث كتابة ابحاث يرجى ارسال المطلوب عن طريق الواتس او الايميل . سوف يتم الرد في اقرب وقت ممكن مع ذكر تاريخ deadline للعمل . handling assignment handling assignment يمكنك إضافة أي خدمة تريدها أو تعديل الخدمات التي تم إدراجها بالفعل. يمكنك إضافة أي خدمة تريدها أو تعديل الخدمات المدرجة بالفعل. يمكنك إضافة أي خدمة تريدها أو تعديل الخدمات المدرجة بالفعل. مهتم في العمل مع CIPD -MBA يرجى ارسال المطلوب عن طريق الواتس او الايميل . سوف يتم الرد في اقرب وقت ممكن مع ذكر تاريخ deadline للعمل . واتساب: 00966562053739 كتابة الأبحاث والتقارير الجامعية ورسائل الماجستير حل واجب الماستر حلول واجبات ادارة الأعمال وكافة التخصصات MBA سلطنة عمان واتساب: 00966562053739 اعداد رسائل واطروحات الماجستير والدراسات العليا كتابة خطط بحث ماستر حل اسايمنت ادارة اعمال حلول اسايمنتات جامعية بحوث تخرج رسالة الماجستير سلطنة عمان واتساب" 00966562053739 كتابة اطروحات ادارة اعمال ابحاث تخرج و كافة التخصصات عمل اطروحة اعداد الأطاريح ورسائل ماجستير بحوث جامعية ماجستير ماستر MBA Business management تخصصات الشريعة والقانون والاجتماع والسياسة وعلوم العسكرية والنفس والفلسفة والمنطق وعلوم القران ليسانس الشريعة والقانون ماجستير القانون العام والعلوم الادارية واتساب: 00966562053739 سارع بالتواصل معنا على الواتساب ولا تضيع الفرصة للتواصل واتساب من داخل سلطنة عمان: 00966562053739 من خارج سلطنة عمان: 00966562053739
 

المرفقات

  • 206852672_2576147602694554_3007172829912649268_n.jpg
    206852672_2576147602694554_3007172829912649268_n.jpg
    65.8 KB · المشاهدات: 1
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
واتس اب: 00966562053739

ايميل : [email protected]

ACT111 المحاسبة المالية

ACT112 المحاسبة الادارية

B 324 التسويق والمجتمع

B122 مقدمة في إدارة التجزئة والتسويق

B123 ممارسات إدارية

B124 مبادئ المحاسبة المالية والإدارية

B205A تنويع الابتكار وريادة الأعمال (1)

B205B تنويع الابتكار وريادة الأعمال (2)

B206 تفهّم العملاء

B207A بناء فرص الأعمال(1)

B207B بناء فرص الأعمال (2)

B291 المحاسبة المالية

B292 المحاسبة الإدارية

B294 التحليل المالي واتخاذ القرارات

B325 الإدارة عبر المنظمات والثقافة

B326 المحاسبة المالية المتقدمة

B327 المشاريع المستدامة والابتكار

واتس اب: 00966562053739

ايميل : [email protected]



BUS101 00966562053739 مقدمة في الرياضيات للأعمال حل واجب

حل واجب 00966562053739BUS102 مقدمة في الإحصاء

حل واجب 00966562053739BUS109 قانون تجاري

حل واجب 00966562053739BUS110 مقدمة فى دراسات الاعمال

حل واجب 00966562053739BUS115 إدارة المشروعات الصغيرة

حل واجب 00966562053739BUS310 إدارة استراتيجية

حل واجب 00966562053739DD209A الإدارة الاقتصاد

حل واجب 00966562053739 DD209B الإدارة الاقتصاد(2)

حل واجب 00966562053739ECO101 مبادئ الإقتصاد الجزئي

حل واجب 00966562053739 FIN240 التمويل الأصغر النظرية والتطبيق

حل واجب 00966562053739FIN241 التمويل الأصغر

حل واجب 00966562053739FIN242 التكنولوجيا المالية

حل واجب 00966562053739MKT111 مبادىْ التسويق 1

حل واجب 00966562053739MKT112 مبادىْ التسويق 2

حل واجب 00966562053739MKT331 التسويق الالكتروني

حل واجب 00966562053739MKT332 تسويق الخدمات

حل واجب 00966562053739SYS111 مبادئ مشاريع التكنولوجيا

حل واجب 00966562053739SYS210 إدارة التكنولوجيا والابتكار

حل واجب 00966562053739SYS280 مبادئ وممارسات أنظمة التفكير

حل واجب 00966562053739SYS380 إدارة تعقيدات الأنظمة

حل واجب 00966562053739B207-B تشكيل الفرص التجارية

حل واجب 00966562053739BUS110 مقدمة في الأعمال

حل واجب 00966562053739BUS310 الإدارة الاستراتيجية

واتس اب: 00966562053739

ايميل : [email protected]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجب 00966562053739M110 البرمجة بلغة البايثون

حل واجب 00966562053739M115 لغة البايثون لتعلم الالة و علم البيانات

حل واجب 00966562053739M140 مقدمة في الأحصاء

حل واجب 00966562053739M218 قواعد البيانات

حل واجب 00966562053739M251 برمجة الكائنات باستخدام جافا

حل واجب 00966562053739M252 برمجة الإنترنت

حل واجب 00966562053739M269 الخوارزميات وهياكل البيانات والحساب.

حل واجب 00966562053739M348 النمذجة الإحصائية التطبيقية

حل واجب 00966562053739M811-A أمن المعلومات أ

حل واجب 00966562053739M811-B أمن المعلومات - الجزء ب

حل واجب 00966562053739MT129 حساب التفاضل والتكامل والاحتمال

حل واجب 00966562053739MT131 الرياضيات المنفصلة

حل واجب 00966562053739MT132 الجبر الخطي

حل واجب 00966562053739T215A الاتصالات وتكنولوجيا المعلومات أ

حل واجب 00966562053739T215B الاتصالات وتكنولوجيا المعلومات ب

حل واجب 00966562053739T216A شبكات سيسكو (CCNA)

حل واجب 00966562053739T216B شبكات سيسكو (CCNA) –B

حل واجب 00966562053739T227 التغيير والاستراتيجية والمشاريع في العمل

حل واجب 00966562053739 T316 الشبكات المتقدمة

حل واجب 00966562053739T318 تطبيق أمن الشبكات

حل واجب 00966562053739TM103 تنظيم الكمبيوتر والهندسة المعمارية

حل واجب 00966562053739TM105 مقدمة في البرمجة

حل واجب 00966562053739TM111 مقدمة في الحوسبة وتكنولوجيا المعلومات 1

حل واجب 00966562053739TM112 مقدمة في الحوسبة وتكنولوجيا المعلومات 2

حل واجب 00966562053739TM129 استخدام التكنولوجيا

حل واجب 00966562053739TM254 إدارة تكنولوجيا المعلومات: الدواعي والاسباب والطرق

حل واجب 00966562053739TM255 تكنولوجيا الاتصالات والمعلومات

حل واجب 00966562053739TM260 الأمن والأخلاق والخصوصية في تكنولوجيا المعلومات والحوسبة

حل واجب 00966562053739 TM270 الذكاء الاصطناعي

حل واجب 00966562053739TM275 الأنظمة المتوازية والموزعة

حل واجب 00966562053739 TM280 أنظمة إنترنت الأشياء الذكية

حل واجب 00966562053739TM340 معالجة اللغات الطبيعية

حل واجب 00966562053739TM341 الرؤية بالحاسب

حل واجب 00966562053739TM351 إدارة البيانات وتحليلها

حل واجب 00966562053739TM352 تقنيات الويب والجوال والسحابة هندسة البرمجيات

حل واجب 00966562053739TM354 هندسة البرمجيات

حل واجب 00966562053739TM355 نولوجيا الاتصالات

حل واجب 00966562053739TM356 تصميم التفاعل وتجربة المستخدم

حل واجب 00966562053739TM471 مشروع التليماتية CS

حل واجب 00966562053739TM471 مشروع التحكم عن بعد CwB

حل واجب 00966562053739TM471 مشروع التليماتية ITC

حل واجب 00966562053739TM471 مشروع التليماتية NS

حل واجب 00966562053739TM471 مشروع التليماتية WD

حل واجب 00966562053739TT284 تقنيات الويب

حل واجب 00966562053739TU170 ساسيات الحوسبة

واتس اب: 00966562053739

ايميل : [email protected]





حل واجب 00966562053739AA100A آ داب الماضي والحاضر (I)

حل واجب 00966562053739AA100B آ داب الماضي والحاضر

حل واجب 00966562053739AR111 مهارات الاتصال في اللغة العربية 1

حل واجب 00966562053739AR112 مهارات الإتصال في اللغة العربية 2

حل واجب 00966562053739AR114 مقدمة في الكتابة الإبداعية باللغة العربية

حل واجب 00966562053739BE322/4 الريادة وإدارة المشروعات الصغيرة

حل واجب 00966562053739E302A الأدب والإبداع 1

حل واجب 00966562053739E302B الأدب والإبداع 2

حل واجب 00966562053739E304A سبر خواص النحو في اللغة الإنجليزية 1

حل واجب 00966562053739E304B سبر خواص النحو في اللغة الإنجليزية 2

حل واجب 00966562053739EA300A ادب الاطفال (1)

حل واجب 00966562053739EA300B ادب الاطفال (2)

حل واجب 00966562053739EL111 مهارات الاتصال في اللغة الإنجليزية ( 1 )

حل واجب 00966562053739EL112 مهارات الاتصال في اللغة الانجليزية ( 2 )

حل واجب 00966562053739EL117 الكتابة

حل واجب 00966562053739EL118 مفهوم القراءة

حل واجب 00966562053739EL119 المهارات الشفوية

حل واجب 00966562053739EL120 علم الأصوات واللسانيات الانجليزية

حل واجب 00966562053739EL121 مقدمة في الأدب

حل واجب 00966562053739EL122 كتابة البحوث

حل واجب 00966562053739EL123 تحليل الخطاب

حل واجب 00966562053739GR101 مهارات التعلم الذاتي

حل واجب 00966562053739GR111 الحضارة العربية الإسلامية

حل واجب 00966562053739GR112 قضايا و مشكلات التنمية في المنطقة العربية

حل واجب 00966562053739GR115 قضايا ومشكلات عالمية معاصرة

حل واجب 00966562053739GR131 تاريخ وحضارة دولة الفرع

حل واجب 00966562053739U214A عوالم اللغة الانجليزية (1)

حل واجب 00966562053739U214B

حل واجب 00966562053739EJ314 تحرير الأخبار والتقارير الصحفية الإلكترونية

حل واجب 00966562053739EJ404 تحليل الخطاب الصحفي

حل واجب 00966562053739ELM201 مادة إعلامية باللغة الإنجليزية

واتس اب: 00966562053739

ايميل : [email protected]





حل واجب 00966562053739ED 111 مدخل إلى التربية

حل واجب 00966562053739ED 121 علم نفس النمو (الطفولة)

حل واجب 00966562053739ED 212 التعليم الابتدائي

حل واجب 00966562053739ED 221 علم النفس التعلم والتعليم

حل واجب 00966562053739ED 222

حل واجب 00966562053739ED 241 المناهج وطرق التدريس العامة

حل واجب 00966562053739ED 247 الدراسات الاجتماعية 1

حل واجب 00966562053739ED 249 التربية الإسلامية لمعلمي المرحلة الابتدائية 1

حل واجب 00966562053739ED 252 طرق تدريس التربية الإسلامية في المرحلة الابتدائية

حل واجب 00966562053739ED 255 اللغة الإنجليزية لمعلمي المرحلة الابتدائية

حل واجب 00966562053739ED 313 إدارة الصف وبيئة التعلم

حل واجب 00966562053739ED 331 تكنولوجيا التعليم

حل واجب 00966562053739ED 332 التدريس بمساعدة الحاسوب

حل واجب 00966562053739ED 347 اللغة العربية لمعلمي المرحلة الابتدائية 1

حل واجب 00966562053739ED 349 اللغة العربية لمعلمي المرحلة الابتدائية 2

حل واجب 00966562053739ED 423 القياس والتقويم وبناء الاختبارات المدرسية

حل واجب 00966562053739ED 431 تصميم البرمجيات التعليمية وإنتاجها

حل واجب 00966562053739ED 442 بحث في تحسين الأداء

حل واجب 00966562053739ED 449 التربية العملية 2

حل واجب 00966562053739ED 456 أدب الأطفال

حل واجب 00966562053739ED 460 العلوم لمعلمي المرحلة الابتدائية 1

حل واجب 00966562053739ED 513 الإدارة التربوية

حل واجب 00966562053739ED 521 علم النفس التربوي

حل واجب 00966562053739ED 523 القياس والتقويم التربوي

حل واجب 00966562053739ED 531 تخطيط المناهج وتطويرها

حل واجب 00966562053739ED 532 تكنولوجيا التعليم وتطبيقاتها التربوية

حل واجب 00966562053739ED 533 مناهج وطرق تدريس التربية الإسلامية

حل واجب 00966562053739ED 534 التربية العملية الميدانية

حل واجب 00966562053739ED 535 مناهج وطرق تدريس اللغة الإنجليزية

حل واجب 00966562053739ED 536 مناهج البحث التربوي

حل واجب 00966562053739ED 537 مناهج وطرق تدريس العلوم

حل واجب 00966562053739ED 538 مناهج وطرق تدريس الرياضيات

حل واجب 00966562053739ED 539 مناهج وطرق تدريس الاجتماعيات

حل واجب 00966562053739ED 540 مناهج وطرق تدريس اللغة العربية

حل واجب 00966562053739ED 541 الإرشاد والتوجيه التربوي

حل واجب 00966562053739ED 601 تحليل المنهج وتطويره

حل واجب 00966562053739ED 613 القيادة التربوية

حل واجب 00966562053739ED 614 الاشراف التربوي

حل واجب 00966562053739ED 617 التخطيط التربوي

حل واجب 00966562053739ED 618 تصميم التدريس

حل واجب 00966562053739ED 620 القيادة وديناميات الجماعة

حل واجب 00966562053739ED 621 السياسات التربوية في العالم العربي

حل واجب 00966562053739 ED 622 قضايا معاصرة في القيادة التربوية

حل واجب 00966562053739ED 623 علم النفس التربوي

حل واجب 00966562053739 ED 627 الاتصال التربوي

حل واجب 00966562053739ED 631 التعليم المفتوح والتعلم عن بعد

حل واجب 00966562053739ED 632 مناهج البحث

حل واجب 00966562053739ED 633 تطبيقات التكنولوجيا في التعليم

حل واجب 00966562053739ED 634 تصميم البرمجيات التعليمية وإنتاجها

حل واجب 00966562053739ED 637 حلقة بحث في القيادة التربوية

حل واجب 00966562053739SP 100 مقدمة في التربية الخاصة

حل واجب 00966562053739SP 202 التدخل المبكر في التربية الخاصة

حل واجب 00966562053739SP 205 تقييم وتشخيص صعوبات التعلم

حل واجب 00966562053739SP 230 اضطرابات اللغة والتواصل

حل واجب 00966562053739 SP 233 بناء وتعديل السلوك

حل واجب 00966562053739SP 241 المناهج والأساليب في التربية الخاصة

حل واجب 00966562053739SP 302 مدخل إلى صعوبات التعلم

حل واجب 00966562053739SP 334 طرق تدريس ذوي صعوبات التعلم

حل واجب 00966562053739SP 336 صعوبات التعلم النمائية وبرامجها التربوية

حل واجب 00966562053739SP 337 صعوبات التعلم الأكاديمية وبرامجها التربوية

حل واجب 00966562053739SP 340 العمل مع أسر غير العاديين

حل واجب 00966562053739SP 343 التدريب الميداني في مجال صعوبات التعلم 1

حل واجب 00966562053739SP 405 القضايا المعاصرة في التربية الخاصة

حل واجب 00966562053739SP 410 الإدارة والإشراف في التربية الخاصة

حل واجب 00966562053739SP 415 دمج ذوي الاحتياجات الخاصة في المدارس العادية

حل واجب 00966562053739SP 499 التدريب الميداني في مجال صعوبات التعلم 2

واتس اب: 00966562053739

ايميل : [email protected]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة 00966562053739A230B

حل واجبات الجامعة العربية المفتوحة 00966562053739 M109

حل واجبات الجامعة العربية المفتوحة 00966562053739 EA300B

حل واجبات الجامعة العربية المفتوحة 00966562053739FIN340

حل واجبات الجامعة العربية المفتوحة 00966562053739M132 واجب

حل واجبات الجامعة العربية المفتوحة 00966562053739E304B

حل واجبات الجامعة العربية المفتوحة 00966562053739 M129

حل واجبات الجامعة العربية المفتوحة 00966562053739EL122

حل واجبات الجامعة العربية المفتوحة 00966562053739FIN341

حل واجبات الجامعة العربية المفتوحة 00966562053739 MT132

حل واجبات الجامعة العربية المفتوحة 00966562053739U214B

حل واجبات الجامعة العربية المفتوحة 00966562053739 MT129

حل واجبات الجامعة العربية المفتوحة 00966562053739 ACC300

حل واجبات الجامعة العربية المفتوحة 00966562053739 FIN342

حل واجبات الجامعة العربية المفتوحة 00966562053739 M269

حل واجبات الجامعة العربية المفتوحة 00966562053739B293

حل واجبات الجامعة العربية المفتوحة 00966562053739M180

حل واجبات الجامعة العربية المفتوحة 00966562053739 ACC302

حل واجبات الجامعة العربية المفتوحة 00966562053739 MKT331

حل واجبات الجامعة العربية المفتوحة 00966562053739M275

حل واجبات الجامعة العربية المفتوحة 00966562053739BE200

حل واجبات الجامعة العربية المفتوحة 00966562053739TM105

حل واجبات الجامعة العربية المفتوحة 00966562053739 B 292

حل واجبات الجامعة العربية المفتوحة 00966562053739 MKT33

حل واجبات الجامعة العربية المفتوحة 00966562053739T103

حل واجبات الجامعة العربية المفتوحة 00966562053739BE201

حل واجبات الجامعة العربية المفتوحة 00966562053739TM111

حل واجبات الجامعة العربية المفتوحة 00966562053739 B205A

حل واجبات الجامعة العربية المفتوحة 00966562053739 M131

حل واجبات الجامعة العربية المفتوحة 00966562053739 TM103

حل واجبات الجامعة العربية المفتوحة 00966562053739BE211/4

حل واجبات الجامعة العربية المفتوحة 00966562053739TM240

حل واجبات الجامعة العربية المفتوحة 00966562053739B205B

حل واجبات الجامعة العربية المفتوحة 00966562053739 MT131

حل واجبات الجامعة العربية المفتوحة 00966562053739 T216A

حل واجبات الجامعة العربية المفتوحة 00966562053739BE300

حل واجبات الجامعة العربية المفتوحة 00966562053739TM351

حل واجبات الجامعة العربية المفتوحة 00966562053739 B207A

حل واجبات الجامعة العربية المفتوحة 00966562053739 M251

حل واجبات الجامعة العربية المفتوحة 00966562053739 T318

حل واجبات الجامعة العربية المفتوحة 00966562053739BE302

حل واجبات الجامعة العربية المفتوحة 00966562053739TT284

حل واجبات الجامعة العربية المفتوحة 00966562053739 B207B

حل واجبات الجامعة العربية المفتوحة 00966562053739 MS102

حل واجبات الجامعة العربية المفتوحة 00966562053739 TM112

حل واجبات الجامعة العربية المفتوحة 00966562053739BE310

حل واجبات الجامعة العربية المفتوحة 00966562053739 AFL111

حل واجبات الجامعة العربية المفتوحة 00966562053739 B291

حل واجبات الجامعة العربية المفتوحة 00966562053739MT395

حل واجبات الجامعة العربية المفتوحة 00966562053739 TM298

حل واجبات الجامعة العربية المفتوحة 00966562053739BUS115

حل واجبات الجامعة العربية المفتوحة 00966562053739 AFL112

حل واجبات الجامعة العربية المفتوحة 00966562053739B324

حل واجبات الجامعة العربية المفتوحة 00966562053739T216B

حل واجبات الجامعة العربية المفتوحة 00966562053739TM354

حل واجبات الجامعة العربية المفتوحة 00966562053739ECO101

حل واجبات الجامعة العربية المفتوحة 00966562053739AR113

حل واجبات الجامعة العربية المفتوحة 00966562053739 B325

حل واجبات الجامعة العربية المفتوحة 00966562053739T227

حل واجبات الجامعة العربية المفتوحة 00966562053739GR101

حل واجبات الجامعة العربية المفتوحة 00966562053739ECO102

حل واجبات الجامعة العربية المفتوحة 00966562053739GR112

حل واجبات الجامعة العربية المفتوحة 00966562053739 B326

حل واجبات الجامعة العربية المفتوحة 00966562053739T316

حل واجبات الجامعة العربية المفتوحة 00966562053739GR131

حل واجبات الجامعة العربية المفتوحة 00966562053739LB170

حل واجبات الجامعة العربية المفتوحة 00966562053739GR118

حل واجبات الجامعة العربية المفتوحة 00966562053739B327

حل واجبات الجامعة العربية المفتوحة 00966562053739 TM260

حل واجبات الجامعة العربية المفتوحة 00966562053739GB102

حل واجبات الجامعة العربية المفتوحة 00966562053739 B392

حل واجبات الجامعة العربية المفتوحة 00966562053739TM352

حل واجبات الجامعة العربية المفتوحة 00966562053739B628

حل واجبات الجامعة العربية المفتوحة 00966562053739TM366

حل واجبات الجامعة العربية المفتوحة 00966562053739B629

حل واجبات الجامعة العربية المفتوحة 00966562053739AR111

حل واجبات الجامعة العربية المفتوحة 00966562053739BUS310

حل واجبات الجامعة العربية المفتوحة 00966562053739AR112

حل واجبات الجامعة العربية المفتوحة 00966562053739FIN240

حل واجبات الجامعة العربية المفتوحة 00966562053739 GR111

DF 101 القراءة للصم

DF 102 التربية الإسلامية للصم

DF 103 مهارات اللغة العربية

DF 104 مهارات التعلم الذاتي للصم (1)

DF 105 تاريخ تعليم الصم

DF 106 توظيف التقنية في تعليم الصم

DF 110 الكتابة للصم

DF 111 مهارات اللغة العربية (2)

DF 112 مهارات التواصل باللغة الإنجليزية (1)

DF 113 الصحة والغذاء

DF 114 علم السمع

DF 115 مهارات التعلم الذاتي للصم (2)

DF 201 مهارات التواصل الكتابي للصم (1)

DF 202 مهارات اللغة العربية (3)

DF 203 مهارات التواصل باللغة الإنجليزية (2)

DF 204 مقدمة في تأهيل الصم

DF 205 التربية الوطنية للصم (1)

DF 206 التربية الفنية

DF 210 مهارات التواصل الكتابي (2)

DF 211 مهارات اللغة العربية (4)

DF 212 علم نفس النمو

DF 213 العلوم الاجتماعية للصم

DF 214 النمو اللغوي للصم ولغة التخاطب الوظيفية للصم وضعاف السمع

DF 215 مدخل إلي علم التفسير

DF 301 علم التعلم والتعليم

DF 302 مهارات اللغة العربية (5)

DF 303 ترجمة المصطلحات والنصوص في مجال العمل

DF 304 تكنولوجية التعليم والاتصال

DF 305 إدارة بيئة العمل المهنية والوظيفية

DF 306 مهارات التواصل الكتابي (3) تطبيقات مهنية ووظيفية

DF 310 التوجيه والإرشاد النفسي للصم

DF 311 مهارات اللغة العربية (6)

ECD 510 نظم تربية الطفل وإدارتها

ECD 511 علم نفس الطفل : النمو والتعلم والإرشاد

ECD 512 صحة وسلامة وتغذية الطفل

ED 111 مدخل إلى التربية

ED 121 علم نفس النمو (الطفولة)

ED 212 التعليم الابتدائي

ED 221 علم النفس التعلم والتعليم

ED 241 المناهج وطرق التدريس العامة

ED 247 الدراسات الاجتماعية 1

ED 248 الدراسات الاجتماعية 2

ED 249 التربية الإسلامية لمعلمي المرحلة الابتدائية 1

ED 250 التربية الإسلامية لمعلمي المرحلة الابتدائية 2

ED 252 طرق تدريس التربية الإسلامية في المرحلة الابتدائية

ED 254 طرق تدريس الدراسات لاجتماعية في المرحلة الابتدائية

ED 255 اللغة الإنجليزية لمعلمي المرحلة الابتدائية

ED 313 إدارة الصف وبيئة التعلم

ED 331 تكنولوجيا التعليم

ED 332 التدريس بمساعدة الحاسوب

ED 347 اللغة العربية لمعلمي المرحلة الابتدائية 1

ED 349 اللغة العربية لمعلمي المرحلة الابتدائية 2

ED 354 طرق تدريس اللغة العربية في المرحلة الابتدائية

ED 359 الرياضيات لمعلمي المرحلة الابتدائية 1

ED 360 الرياضيات لمعلمي المرحلة الابتدائية 2

ED 364 طرق تدريس الرياضيات في المرحلة الابتدائية

ED 421 مبادئ الإرشاد والتوجيه التربوي والمدرسي

ED 423 القياس والتقويم وبناء الاختبارات المدرسية

ED 431 تصميم البرمجيات التعليمية وإنتاجها

ED 442 بحث في تحسين الأداء

ED 449 التربية العملية 2

ED 456 أدب الأطفال

ED 460 العلوم لمعلمي المرحلة الابتدائية 1

ED 462 العلوم لمعلمي المرحلة الابتدائية 2

ED 468 طرق تدريس العلوم في المرحلة الابتدائية

ED 482 العلوم البيئية والصحية

ED 513 الإدارة التربوية

ED 521 علم النفس التربوي

ED 523 القياس والتقويم التربوي

ED 531 تخطيط المناهج وتطويرها

ED 532 تكنولوجيا التعليم وتطبيقاتها التربوية

ED 533 مناهج وطرق تدريس التربية الإسلامية

ED 534 التربية العملية الميدانية

ED 535 مناهج وطرق تدريس اللغة الإنجليزية

ED 536 مناهج البحث التربوي

ED 537 مناهج وطرق تدريس العلوم

ED 538 مناهج وطرق تدريس الرياضيات

ED 539 مناهج وطرق تدريس الاجتماعيات

ED 540 مناهج وطرق تدريس اللغة العربية

ED 541 الإرشاد والتوجيه التربوي

ED 601 تحليل المنهج وتطويره

ED 613 القيادة التربوية

ED 614 الاشراف التربوي

ED 617 التخطيط التربوي

ED 618 تصميم التدريس

ED 620 القيادة وديناميات الجماعة

ED 621 السياسات التربوية في العالم العربي

ED 622 قضايا معاصرة في القيادة التربوية

ED 623 علم النفس التربوي

ED 624 التطوير التنظيمي للمؤسسات التربوية

ED 626 اقتصاديات التعليم

ED 627 الاتصال التربوي

ED 631 التعليم المفتوح والتعلم عن بعد

ED 632 مناهج البحث

ED 633 تطبيقات التكنولوجيا في التعليم

ED 634 تصميم البرمجيات التعليمية وإنتاجها

ED 635 الوسائط المتعددة

ED 636 تطبيقات الانترنت في التعليم

ED 637 حلقة بحث في القيادة التربوية

ED 639 موضوعات خاصة في تكنولوجيا التعليم

ED 640 تكنولوجيا التعليم لذوي الاحتياجات الخاصة

ED 641 تطبيقات الحاسوب في التحليل الإحصائي

ED 642 تخطيط مشاريع تكنولوجيا التعليم وإدارتها

ED 644 إدارة المعرفة

ED 645 السلوك التنظيمي في المؤسسات التربوية

GR 100 مهارات الحاسوب والإنترنت

GR 101 مهارات التعلم الذاتي

GR 111 تاريخ الحضارة العربية الإسلامية

GR 112 قضايا ومشكلات التنمية في الوطن العربي

GR 115 قضايا ومشكلات عالمية معاصرة

GR 118 المهارات الحياتية والتعايش

GR 121 البيئة والصحة

GR 131 تاريخ وحضارة دولة

LAW 107 حقوق الانسان في القانون الدولي

SP 100 مقدمة في التربية الخاصة

SP 202 التدخل المبكر في التربية الخاصة

SP 205 تقييم وتشخيص صعوبات التعلم

SP 230 اضطرابات اللغة والتواصل

SP 233 بناء وتعديل السلوك

SP 241 المناهج والأساليب في التربية الخاصة

SP 302 مدخل إلى صعوبات التعلم

SP 325 التعلم باللعب

SP 334 طرق تدريس ذوي صعوبات التعلم

SP 336 صعوبات التعلم النمائية وبرامجها التربوية

SP 337 صعوبات التعلم الأكاديمية وبرامجها التربوية

SP 340 العمل مع أسر غير العاديين

SP 343 التدريب الميداني في مجال صعوبات التعلم 1

SP 405 القضايا المعاصرة في التربية الخاصة

SP 410 الإدارة والإشراف في التربية الخاصة

SP 415 دمج ذوي الاحتياجات الخاصة في المدارس العادية

SP 499 التدريب الميداني في مجال صعوبات التعلم 2
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]



حل واجب E304B(اسايمنتE304B & بروجكت) حلول واجبات الجامعة العربية المفتوحةE304B

حل واجب E304B(اسايمنت & بروجكت) حلول واجبات E304B الجامعة العربية المفتوحة

TMA Arab Open University
FACULTY OF LANGUAGE STUDIES
E304B: Exploring English Grammar II
2022/2023
TMA (First Semester)
Prepared by Course Chair: Dr. Marine Milad
Copyright ©2022-2023 Arab Open University
TMA
Please return your completed assignment to arrive no later week 11.
In this assignment you will write an essay of 1000 words based on analysis and interpretation of linguistic data. The assignment assesses your ability to accurately describe and interpret linguistic data. It relates to your study of Blocks 1 and 2, and 3 and represents 15% of the overall continuous assessment score (OCAS).
Before you start this assignment, refer to the general guidance on writing assignments in the module guide. While the TMA contains different steps, you will be given a holistic mark for the assignment.
The TMA consists of three parts, each of which consists of a series of steps.
Please submit your TMA as a single word document.
Part 1: Choosing two texts
Part 2: Grammatical analysis
Step 1: Reading the texts
Step 2: Taking initial notes about the texts (not for submission)
Step 3: Analyzing the texts
Step 4: Writing up your interpretation (1000 words)
Part 1: Choosing two texts
Choose two media reports/articles on the same event/topic; one report/article from a newspaper/magazine published in English in Britain or the United States and one from an Arab newspaper/magazine published in English (e. g. Kuwait Times, Gulf Times, etc.).
The texts you choose should be 200-250 words in length and should also be RECENT; i.e. published over the last 2-4 weeks. You can access most daily newspapers or magazines on the internet.
You should expect to spend a reasonable amount of time selecting your texts, as your choice of text will potentially affect the quality of your answer. Do not be afraid to reject your initial choice if you come across something better, since you will inevitably have gained insights from the process of selection. However, you need to remember to leave yourself enough time to spend on the analysis of your chosen texts.
Part 2: Grammatical analysis
Step 1: Reading the texts
Read carefully the two texts that you chose. Your assignment is to write a linguistic comparison of the two texts of 1000 words which evidences and explains the different ways in which the two newspapers represent the same event. Note that you do not need to write anything for this step.
Step 2: Making initial notes about the texts
Make some notes on what you notice about the texts and how they differ in terms of the way in which they represent the same event/topic. This will provide you with a set of questions or hypotheses which you can explore. You will not be assessed on this step and you should not include your notes in your submission.
Step 3: Analyzing the two texts
Analyze the texts, focusing on some lexicogrammatical choices relating to field. It will help you if you divide the texts into clauses using clause boundaries: || indicate a boundary for an independent or dependent clause; [[…]] indicate embedded clause boundaries; and << … >> indicate interrupting clause boundaries. Please note that there is inevitably some variation in how grammarians analyze clauses, so don’t worry if you would have made slightly different choices (for the purposes of this TMA you should follow the clause analysis presented in the module textbooks). Below are some suggestions as to what you might want to focus on, but you can look at other features you feel are relevant or significant:
choice of lexis
noun groups/phrases constituents
process types
voice (i.e. passive/active)
participant types
noun groups
circumstance types
It will help you demonstrate knowledge and skills in grammatical analysis if you use color-coding or another kind of annotation system to mark up the texts. You should display your analysis in tables
Step 4: Writing up your interpretation
Drawing on the parts of your analysis that you find most illuminating, write an essay in a word document of up to 1000 words (not including the appendix) on what the analysis reveals about the main similarities and differences between the two texts. Relate your discussion where possible to the context of the texts as this relates to the register variable of field (that is, the topic being discussed, how it is being represented, and why). Your interpretations must relate to your analysis (Step 3). For instance, if you have focused on the choice between active/passive voice and process types, you will discuss the effects of these choices. You should include examples from the texts in your interpretation to support and evidence the specific points you are making. You will need to be selective in the data that you include. Make sure that you select the data that relates to and supports your interpretation (Step 3). If you include too much data, this will detract from your ability to put together a clear and convincing interpretation.
You should write up to 1000 words.
Important notes:
Your chosen texts MUST be approved and signed by your tutor to make sure they are the proper texts for the TMA, otherwise your TMA will not be accepted and will not be marked; your mark will be zero.
You should write an introduction to the TMA. You should also write a conclusion to the whole TMA at the end in which you sum up what you have done in the TMA and state your own evaluation and opinion of the TMA.
Make sure you use a good number of references for your TMA from any source from which you should use relevant in-text well referenced citations/quotations to support your discussions, explanations and arguments to make your TMA well researched, well argued, and more convincing. This will help you get a better mark. (see the Assessment Guide on referencing)
In an appendix attach a photocopy or a printout of the two texts you have used for analysis.
End of TMA Questions
Using the e-library on campus:
Students are requested to visit the e-library on campus and use it to do their TMAs properly. They are also requested to show their tutor that they used the e-library in doing the TMA and this be evidenced.
The following are guidelines on plagiarism:
If you submit an assignment that contains work other than yours without acknowledging your sources, you are committing plagiarism. This might occur when:
Using a sentence or phrase that you have come across
Copying word-for-word directly from a text
Paraphrasing the words from the text very closely
Using text downloaded from the internet
Borrowing statistics or assembled fact from another person or source
Copying or downloading figures, photographs, pictures or diagrams without acknowledging your sources
Copying from the notes or essays of a fellow student
(Slightly adapted from OU document on quoting versus plagiarism)
It is important to remember that plagiarism is strictly barred and would be subject to punitive action by the Arab Open University.


حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]


حل واجبTM352حل واجبات TM352 الجامعه العربيه المفتوحه 00966562053739
حل واجبات الجامعة العربية المفتوحة واتس 00966562053739 بعد سنوات من الخبرة في كتابة البحوث الجامعية و بحوث التخرج و تقارير كثيرة و اسايمنتات و بروجكتات و بدون نسبة اقتباس نقوم بإنجاز بحثك الجامعي من الألف إلى الياء , من صفحة الغلاف حتى نهاية صفحة المصادر تواصل معنا على الواتساب لنقدم لك خدمة كتابة بحوث جامعية بدون نسبة اقتباس ! نقوم بفحص نسبة التشابه على برنامج ال Turnitin لتتأكد أن بحثك خالي من النسخ واللصق ! نكتب بلغتين عربي و انجليزي حلول واجبات الجامعة العربية المفتوحة وا...



TMA Arab Open University
TM352: Web, mobile and cloud technologies
Tutor-Marked Assignment (Fall 22/23)
Cut-Off Date: Based on the Published Deadline. Total Marks: 100 marks turned to 15 marks Contents
Warnings and Declaration…………………………………….………………………………......1
Phase 1 ………………….……………………………………………………………………...….2
Phase 2 ……….…………………………………………………………………………….…..….2
Phase 3 …………..…..…………………………………………………………………….…..…..3
Plagiarism Warning:
As per AOU rules and regulations, all students are required to submit their own TMA work and avoid plagiarism. The AOU has implemented sophisticated techniques for plagiarism detection. You must provide all references in case you use and quote another person's work in your TMA. You will be penalized for any act of plagiarism as per the AOU's rules and regulations.
Declaration of No Plagiarism by Student (to be signed and submitted by student with TMA work):
I hereby declare that this submitted TMA work is a result of my own efforts and I have not plagiarized any other person's work. I have provided all references of information that I have used and quoted in my TMA work.
Name of Student:…………………………….. Signature:…………………………………………... Date:…………………………………………………
Assignment description
Develop a web-based project to maintain security groups and their members in order to apply system security policy. The system user could sign in as an employee, or system administrator.
Phase 1 (GUI) [30 marks]
At phase 1, develop the client-side interface in such a way that could access the system via web browser while the system administrators should access the system via a java application. [5 marks]
Ensure that the following tasks are properly provided: [25 marks]
For employee users
After a successful login process the employee should be able to view all his access rights from different groups. The members, groups and associated security rules are, previously saved as JSON file(s) in the server, should be retrieved and displayed.
For system administrators:
After a successful login process, system administrator should be able to view all available security groups.
System administrator should be able to add, delete or modify groups and their members and access rights.
System administrator should be able to search for security rules by resources, access rules, groups, and members.
Hint:provide the necessary attributes and GUI interfaces and use the necessary communicating protocol.
Phase 2 (Server-side service) [60 marks]
At phase 2, develop web-side services using the JAVA programming languages. For each task required in phase one, you should provide a website service using JAVA and provide the required security for your services to grant access only to authorized users.[each 10 marks]
Here are some details regarding the functionality of some services:
View all groups and their members: this service should retrieve groups and their members along with stored rules on the server-side that exists in a file (JSON format).
Add a group/member: this service should add a group/member to a file; stored as JSON. If the group/member with the same specifications has been previously added, an error message should be displayed and the new group/member should not be stored.
Delete a group/member: this service should update the various associated file(s).
Modify a group data: this service should update the corresponding files with the new information received from client side which could be the members of the group or group access rights.
Search for security rules: this service should enable the system administrator to search for search for security rules by resources, access rules, groups, and members..
View all security rules: this service should retrieve stored rules on the server-side that exists in a file (JSON format).
Hint:Use the appropriate presentation format to save and read the necessary attributes to and from file.
Phase 3 (Using Cloud services) [10 marks]
The system is to be deployed over the Cloud for saving organization the cost of servers and other equipment and make use of remote resources. Answer the following with justification
Which cloud deployment model should be used
Which cloud services should be used
Instructions:
Submit two files
one zip file containing all the project's folders, assuming that you are using NetBeans to develop your TMA, then you are required to send the whole project folder as a single zip file.
Use the following format to name your zip file:
TM352-TMA-Fall-22_23-Branch-StudentName-ID
Put in a word file
codes of client side, the operations of the web services as well as screenshots after running each service.
needed xml files.
answers of phase 3.
Use the following format to name your word file:
TM352-TMA- Fall-22_23-Branch-StudentName-ID.docx
Kindly notice that violating the instructions would cause mark deduction






حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات 00966562053739 الجامعة الجامعة العربية المفتوحة حلول واجبات الجامعة العربية المفتوحةAOU summer Course MBA

حل واجبات cipd و كتابة أبحاث جامعية الامارات كافة التخصصات و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



حل واجبات cipd و كتابة أبحاث جامعية الاردن و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



حل واجبات cipd كتابة أبحاث جامعية لبنان و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



كتابة بحوث كلية مجان الجامعية 00966562053739 ابحاث إدارة الأعمال كتابة بحوث جامعة مجان mba اعداد بحث تخرج business management operation master



حل واجبات الجامعة الامارات 00966562053739 بحوث تخرج حل واجب ماجستير ماستر بكالوريوس MBA Business management



كتابة رسائل الماجستير 00966562053739 ادارة الأعمال , اعداد رسالة ماستر و ابحاث علمية كافة التخصصات حل واجبات ماجستير بحوث تخرج MBA business management



حل واجبات ادارة اعمال واتساب 00966562053739 الكويت البحرين سلطنة عمان الامارات الاردن لبنان

عمل مشاريع تخرج و ابحاث جامعية ورسائل علمية - كتابة ابحاث EMBA بحوث حل واجب حلول واجبات MBA بكالريوس ماستر ماجستير دكتوراه Phd MD theses كتابة ابحاث ومشاريع تخرج 00966562053739 عمل بحوث اعداد بحث تسويقي خطة تسويق ماركيتنج MBA كتابة خطط تسويقية حل واجب حلول واجبات ادارة أعمال كتابة ابحاث روسائل علمية ومشاريع تخرج كتابة بحوث التخرج والرسائل لكافة التخصصات حل واجب حلول واجبات مشروع التخرج كتابة تقارير و ابحاث لطلاب
حل واجبات الموارد البشريه - مساعدة في ماجستر ادارة الاعمال - CIPD -MBA shrm - assignments
cipd mba shrm assignments MBA . CIPD . SHRM . PMP and other courses
المساعدة في حل واجبات الموارد البشرية وكتابة رسالة الماجستير00966562053739



خدمات كتابة بحوث جامعية و عمل مشروع تخرج و كتابة ابحاث
خدمات كتابة بحوث جامعية و عمل مشروع تخرج و كتابة ابحاث
موقع يقدم خدمات كتابة بحوث جامعية و عمل مشروع تخرج و كتابة ابحاث
لو كنت طالب جامعي ولا تتفرغ يمكننا القيام بأعمالك نيابة عنك , فنحن نقوم أيضاً ب فحص نسبة الاقتباس باستخدام ال Turnitin نفس البرنامج المستخدم في الجامعات و نصور لك النسبة لتعرف نسبة البحث.
نقوم بالكتابة بدون كوبي بيست , الكتابة تلتزم بالمعايير الجامعية وبإمكانك بعدها مناقشة بحثك مع الدكتور بدون أي خوف.
سنوات من الخبرة في كتابة تقارير جامعية لعدد كبير من الطلبة في عدة جامعات
بالعربية والانجليزية
يرجى التواصل معنا على الواتساب للطلب:
00966562053739

بحوث جامعية , كتابة بحوث , عمل بحوث

كتابة بحوث باللغه الانجليزيه : ماستر موارد بشرية بكالوريوس إدارة اعمال master dissertation thesis كتابة رسائل ماجستير الادارة اعداد رسالة ماستر بحوث تخرج بإحترافيه عالية وسرعة التنفيذ
تواصل واتس اب 00966562053739
اعداد بحوث تخرج ادارة اعمال وكتابة ابحاث MBA لطلاب الماستر والابتعاث كتابة ابحاث التخرج ورسالة الماجستير CIPD -MBA - جامعة اليمامه - كلية الامير سلطان -مساعدة في كتابة رسالة الماجستير ادارة اعمال. handling assignment
حل واجبات الموارد البشريه والمحاسبة والتمويل والتسويق كتابة بحوث مع CIPD -MBA نساعد في اختبارات CIPD وماستر اداراة الاعمال00966562053739
Get Easy Writing Help With Experts Get Easy Writing Help With Experts
كتابة بحوث باللغه الانجليزيه : ماستر تسويق اقتصاد موارد بشرية إدارة اعمال ادارة مشاريع سلاسل امداد وقنوات التوزيع
بحوث تخرج بإحترافيه عالية وسرعة التنفيذ حل واجب CIPD شهادة ادارة وتنمية الموارد البشرية
و عمل بحوث تخرج ماجستير كتابة ابحاث ادارة اعمال ماجستير/ ماستر mba حلول واجبات business management معهد / دبلوم / ماستر / كلية / جامعة باللغه الانجليزيه00966562053739



نتميز معكم في حلول واجبات الجامعة العربية المفتوحة بأعلى جودة واتقان حلول واجبات الجامعة العربية المفتوحة في كافة الأقسام
مدرس English لطلاب الجامعة العربية المفتوحة وجامعة الخليج gust وحل الواجبات وحل اسينمت وكتابة ال essay essay writingو empower300 assignment
empower3000 homework articles

achieve3000 asignment homework artcles

حل واجب engl 11056 , engl 110 وحل واجب el117 وحل واجب el120

حل واجب el121وحل واجب lb160وحل واجب tu17000966562053739
EL117 , EL118 , EL119 , EL120 , EL121, A150, U210/A , U214A , U210/B , U214B , E300A , EA300A , E300B, EA300B , E303A, E301A , E303B, E301B , A319A , A319B, A123/A, AA100A , A123/B , AA100B , A210A , A230A , A210B , A230B , CH101 , SP101 , FR101 , EL230, EL320 , EL340
 

المرفقات

  • 206852672_2576147602694554_3007172829912649268_n.jpg
    206852672_2576147602694554_3007172829912649268_n.jpg
    65.8 KB · المشاهدات: 0
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات 00966562053739 الجامعة الجامعة العربية المفتوحة حلول واجبات الجامعة العربية المفتوحةAOU summer Course MBA

حل واجبات cipd و كتابة أبحاث جامعية الامارات كافة التخصصات و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



حل واجبات cipd و كتابة أبحاث جامعية الاردن و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



حل واجبات cipd كتابة أبحاث جامعية لبنان و ادارة اعمال بكالوريوس | ماستر ماجستير واتساب 00966562053739



كتابة بحوث كلية مجان الجامعية 00966562053739 ابحاث إدارة الأعمال كتابة بحوث جامعة مجان mba اعداد بحث تخرج business management operation master



حل واجبات الجامعة الامارات 00966562053739 بحوث تخرج حل واجب ماجستير ماستر بكالوريوس MBA Business management



كتابة رسائل الماجستير 00966562053739 ادارة الأعمال , اعداد رسالة ماستر و ابحاث علمية كافة التخصصات حل واجبات ماجستير بحوث تخرج MBA business management



حل واجبات ادارة اعمال واتساب 00966562053739 الكويت البحرين سلطنة عمان الامارات الاردن لبنان


نتميز معكم في حلول واجبات الجامعة العربية المفتوحة بأعلى جودة واتقان حلول واجبات الجامعة العربية المفتوحة في كافة الأقسام
مدرس English لطلاب الجامعة العربية المفتوحة وجامعة الخليج gust وحل الواجبات وحل اسينمت وكتابة ال essay essay writingو empower300 assignment
empower3000 homework articles

achieve3000 asignment homework artcles

حل واجب engl 11056 , engl 110 وحل واجب el117 وحل واجب el120

حل واجب el121وحل واجب lb160وحل واجب tu17000966562053739
EL117 , EL118 , EL119 , EL120 , EL121, A150, U210/A , U214A , U210/B , U214B , E300A , EA300A , E300B, EA300B , E303A, E301A , E303B, E301B , A319A , A319B, A123/A, AA100A , A123/B , AA100B , A210A , A230A , A210B , A230B , CH101 , SP101 , FR101 , EL230, EL320 , EL340
 

المرفقات

  • 206852672_2576147602694554_3007172829912649268_n.jpg
    206852672_2576147602694554_3007172829912649268_n.jpg
    65.8 KB · المشاهدات: 1
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






Arab Open University
Faculty of Business Studies
B207A- Shaping Business Opportunities I
Second Semester 2022-2023- Tutor Marked Assessment

I. TMA overview


This TMA is intended to assess the following:
• Your knowledge and understanding of the key concepts covered in Block 1 (weeks1-10)
• Your ability to apply the course ideas to real business examples.
• Your ability to use academic business and management language appropriately and effectively to communicate your ideas.
• Your ability to critically analyze business topics and ideas.
• Your ability to work and communicate with a team.
This is a group TMA. Each team will consist of 3-4 students. (Consult with your tutor if it’s not possible to form a group).
This TMA consists of 15% of your total course grade.
• Teams of the same section should select different ideas for this TMA.
• The initial task of your team is to select an innovative organization and ask for tutor approval.
• Teams should arrange with their tutors to verify that no other team had selected the same organization.



II. TMA Topic and requirements


Innovation is a crucial element for economic and organizational success. If a company wants to compete it must be both adaptive and creative. The focus of this TMA is to select an example (preferably a local example) of organizational innovation associated with its business functions- marketing and/or operations management- and analyze the importance of this innovation. This TMA is not about innovative products, but rather innovative processes and methods that organizations implement through their business functions (marketing or operations) to gain competitive advantage such as finding new suppliers, creating new production methods, creating a new advertising strategy, etc...
This TMA encourages students to develop greater critical analysis skills in application to the theories and course material they learned in B207A. This assignment is an analysis and not a copy paste of information from sources.
III. Essay Paper (100 marks out of 100)(1500 words)

Your answer should be in the form of an essay. The essay should be well organized, that is, it has an introduction(5 marks), body(90 marks)and conclusion(5 marks). The introduction should introduce the topic.
In the body paragraphs, the following points should be discussed:
1. Name the organization and briefly describe its products, markets and activities.(10 marks)
2. How was the organization able to become innovative? Link to the theories discussed in the course material. (20 marks)
3. Discuss how the two business functions (marketing and operations) would identify and address this organization’s innovation needs. Link to the theories discussed in the course material.(20 marks)
4. Discuss the selected process innovation (marketing and/or operations). Which problem did it solve? Which added value did it bring? Link to the theories discussed in the course material.(20 marks)
5. Analyze how the process innovation was implemented and its benefits.(10 marks)
6. Discuss the post COVID-19 challenges and opportunities for the organization. (10 marks).

Instructions for students:
• Each team will work on the paper as they would normally do with other courses, but this time in a group. This is a good opportunity for students to learn a set of skills that are very important in the professional business world, such as time management, planning, communicating with others, etc.
• Each team is required to select a team leader. The TMA paper should be uploaded to the LMS by the team leader only. This is a very important requirement in order to avoid Turnitin similarities.
• The names of all the team members should be written on the pt3 form, including the name of the team leader. All team members will receive the same mark on the TMA essay paper.Students are required to use the pt3 form provided on the LMS for this specific TMA.
• Students’ papers are expected to meet the following criteria:
o Plagiarism: It’s imperative that team members write the TMA using their own words. Plagiarism will be penalized depending on its severity and according to AOU plagiarism policy.
o Format: team members are expected to write their answer in an essay format: introduction, body paragraph(s) and a conclusion. Failing to do so could result in the deduction of up to 4 marks from the total TMA paper mark.
o Word count: TMAs are expected to be within the specified word count. A 10% deviation from word count limit is acceptable. Not adhering to specified word count could result in the deduction of up to 4 marks of the total TMA paper mark.
o Referencing: team members are expected to use the Harvard referencing style for in-text referencing and list of reference at the end. Failing to do so could result in the deduction of up to 4 marks of the total TMA paper mark.
o E-Library: team members are expected to use E-library sources to support their answers. A minimum of 3 sources is required. Failing to do so could result in the deduction of up to 4 marks of the total TMA paper mark.




حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






Arab Open University
Faculty of Business Studies
B207B- Shaping Business Opportunities II
Second semester 2022-2023- Tutor Marked Assessment
I. TMA overview
This TMA is intended to assess the following:
● Your knowledge and understanding of the key concepts covered in (weeks1-10)
● Your ability to apply the course ideas to real business examples
● Your ability to use academic business and management language appropriately and effectively to communicate your ideas
● Your ability to critically analyze business topics and ideas.
● Your ability to work and communicate with a team

This is a group TMA. Each team will consist of 3-4 students. (Consult with your tutor if it’s not possible to form a group).
This TMA consists of 15% of your total course grade.
● Teams of the same section should select different ideas for this TMA.
● The initial task of your team is to select an innovative organization and ask for tutor approval.
● Teams should arrange with their tutors to verify that no other team had selected the same organization.
II. TMA Topic and requirements


The global trade environment and the dynamics of competition among organizations are the most important topics for understanding and practicing management in today’s markets. The focus of this TMA is to select an example of a successful global organization/brand and discuss the factors that had led to its success along with the challenges that it faces in operating globally.
This TMA encourages students to develop greater critical analysis skills in application to the theories and course material they learned in B207B. This assignment is an analysis and not a copy paste of information from sources.
1. Essay Paper (100 marks out of 100) (1500 words)

Your answer should be in the form of an essay. The essay should be well organized, that is, it has an introduction (5 marks), body (90 marks) and conclusion (5 marks). The introduction should introduce the topic.
In the body paragraphs, the following points should be discussed:
1. Name the global brand/organization and briefly describe its products and activities. (10 marks)
2. What does it mean to be a global organization? Why is your chosen organization global? Link to the theories discussed in the course material. (10 marks)
3. There are many factors that could trigger an organization to expand across international boundaries. Discuss these factors and link your discussion to your chosen organization. (20 marks)
4. Discuss the main success factors of the global brand. What is its marketing strategy, competitors and competitive advantage? (10 marks)
5. Discuss the concept of globalization vs. customization and the measures taken by the global brand to recognize that offerings and communication should be adapted to local preferences and conditions. Support your answer with solid examples and Link to the theories discussed in the course material. (20 marks)
6. Discuss the ethical considerations for the global organization. Support your answer with solid examples and Link to the theories discussed in the course material. (10 marks)
7. Discuss the post COVID-19 challenges and opportunities for the organization. (10 marks)
Instructions for students:
● Each team will work on the paper as they would normally do with other courses, but this time in a group. This is a good opportunity for students to learn a set of skills that are very important in the professional business world, such as time management, planning, communicating with others, etc.
● Each team is required to select a team leader. The TMA paper should be uploaded to the LMS by the team leader only. This is a very important requirement in order to avoid Turnitin similarities.
● The names of all the team members should be written on the pt3 form, including the name of the team leader. All team members will receive the same mark on the TMA essay paper. Students are required to use the pt3 form provided on the LMS for this specific TMA.
● Students papers are expected to meet the following criteria:
o Plagiarism: It’s imperative that team members write the TMA using their own words. Plagiarism will be penalized depending on its severity and according to AOU plagiarism policy.
o Format: team members are expected to write their answer in an essay format: introduction, body paragraph(s) and a conclusion. Failing to do so could result in the deduction of up to 4 marks from the total TMA paper mark.
o Word count: TMAs are expected to be within the specified word count. A 10% deviation from word count limit is acceptable. Not adhering to specified word count could result in the deduction of up to 4 marks of the total TMA paper mark.
o Referencing: team members are expected to use the Harvard referencing style for in-text referencing and list of reference at the end. Failing to do so could result in the deduction of up to 4 marks of the total TMA paper mark.
o E-Library: team members are expected to use E-library sources to support their answers. A minimum of 3 sources is required. Failing to do so could result in the deduction of up to 4 marks of the total TMA paper mark.





حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]








Faculty of Business Studies
Arab Open University


Managing Organizational Change
SYS380


Tutor Monitoring Assignment
Spring 2023






MANAGING CHANGE IN SMEs


The challenges of sustaining local Small and Medium Enterprises ( SMEs) continues despite the economic and governmental support obtained for setting and developing SMEs within economies. Reflecting on SMEs in your context, analyse the challenges faced in the business and pressures in the business if you are appointed as a change agent to improve the SMEs.

As a change agent, you are required to present a professional report to the owners of the business. The report submitted is about 2500 words that evaluates change and resistance to change. Your evaluation as a change agent should focus on the following:

1. Background of the SME local sector you have chosen being it a restaurant, a convenience store, a local service provider, boutique , café or any local form of SME that needs to consider change to sustain growth or maintain its market niche (15 marks).

2. Explain the environmental pressures for change (fashion, demography, external mandate, etc.) and critically analyse the SME sector you have chosen in this context and what were the main drivers towards change (25 marks).

3. Explain how change can take place and what challenges can a change manager face and how s/he should deal with them. Reflect in your answer on the SME sector you have chosen by analysing the nature of changes that took place and challenges faced and how it was dealt with (45 marks).

4. Explain resistance to change and how such resistance can be managed. Analyse the case you have chosen from this perspective by reflecting on the most appropriate approach to manage resistance to change in the SME sector you have chosen (15 marks).

Guidance
- Assignment to be done in groups of minimum 3 students , maximum of 4 students is allowed
- Research about the SME you are to choose as your case study before you start your assignment to ensure that you have the needed information.
- You should present your discussion in an essay format with an introduction and a conclusion.
- You are to think outside the box. You might find out new pressures or challenges pushing the case you have chosen to change.
- Ensure to provide a list of references ( at least three should be from the e-library)

















GENERAL INSTRUCTIONS FOR STUDENTS

1. Cut-off date: Specific date to be specified later by deanship. If you feel that you are unable to meet the cut-off date of the TMA because of unusual circumstances, please contact your tutor as soon as possible to discuss a possible extension to the cut-off date. The exact cut-off date will be assigned in due course.
TMA weight: 20% of total course grade.
2. Course material:
- Chapters 3, 4, 5 and 8.
3. Format: Write your answers in essay format. Failing to do so could result in grade deduction from presentation marks up to 5 marks. You may, however, use bullet points, diagrams, tables, or any graphs to support your arguments.
4. Plagiarism: Write your answers using your own words. Plagiarism will be penalized depending on its severity and according to AOU plagiarism policy (Enclosed after these instructions you will find the Arab Open University Rules of Cheating and Plagiarism).
5. Word count: Answers are expected to be within +/- 10% of the word limit. Answers that fall below or above this range can lose up to 5 marks.
6. Referencing: Use Harvard referencing style for in-text citation and make a table of references at the end. Failing to do so could result grade deduction of referencing marks up to 5 marks.
7. Research: Use a minimum of two additional sources of information. It is strongly recommended that you use scholarly articles found in the E-library at LMS. You can lose up to 5 marks if you do not use at least two external sources. In addition, although text books assigned in the course may be used freely as references, you are required to use a minimum of three external sources. It is recommended that you use scholarly studies found in the E-library link at the LMS. Failing to do so could result in grade deduction of referencing marks up to 5 marks. If you do not find required additional information at the e-library, you can always refer to Google scholar.
8. PT3 Form: Attach PT3 form to the assignment, named and signed.






The Arab Open University Rules about Plagiarism

The Arab Open University Definitions of cheating and plagiarism
According to the Arab Open University By-laws, “The following acts represent studies of cheating and plagiarism:
● Verbatim copying of printed material and submitting them as part of TMAs without proper academic acknowledgement and documentation.
● Verbatim copying of material from the Internet, including tables and graphics.
● Copying other students’ notes or reports.
● Using paid or unpaid material prepared for the student by individuals or firms.
● Utilization of, or proceeding to utilize, contraband materials or devices in examinations.”

Examples of Plagiarism
Copying from a single or multiple sources, this is where the student uses one or more of the following as the basis for the whole, or a good part, of the assignment:
1. Published or unpublished books, studies or reports
2. The Internet
3. The media (e.g.TV programmes, radio programmes or newspaper studies)
4. An essay from an essay bank
5. A piece of work previously submitted by another student
6. Copying from a text which is about to be submitted for the same assignment








حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]





FacultyofBusinessStudies

ArabOpenUniversity


ManagingAcrossOrganizational&CulturalBoundariesB325


TutorMonitoringAssignment–Version2

Spring2023

QUESTION


B325TMA–Spring2023–SB


Page1




TMAintroduction
Thebasisoflocal,regional,andglobalcompetitionhaschanged.Nowadays,itisnolongeraracebetweenbusinessesinrelationtootherbusinesses,butratherthecompetitionbetweensupplychains.Therefore,companiesmovetomanagesupplychaincollaborationinwhichthereistheparticipationofmanyfirms,includingsuppliers,manufacturers,transporters,intermediaries,takinguponeorsomeworkphrase(suchasmarketing,logistic,finance…)andcollaboratingtoachievecompetitiveadvantage.Thus,supplychaincollaborationisbecomingessentialstrategyforanysuccessfulbusiness.Yetobstacles(suchasdistinctivelevelsgoals,differencesinculture……)tosupplychaincollaborationarepersistent.

QUESTION
ChoosealargeDEPARTMENTSTOREfromyourregionorlocalcontextthathasbestsupplychainpracticeswithinternationalpartnerandprepareareportforsupplychaincollaboration.Thereportneedstoincludeaclearintroductionofthechosenlargedepartmentstoreandanalysethechallengesfacingthedepartmentstoreregardingsupplychainmembers’differentgoalsandculturechallengesandsuggestactionstobetakentotacklethesechallenges.Itneedstoclearlyidentifythegoalsinsupplychainnetworksandcriticallyevaluatethechallengesthatarisefrommulticulturalcollaborationaswellasstrategiesusedtodealwiththesechallenges(wordlimit:2000words).

IMPORTANT GUIDELINES:
1- What you need to consider before you start your TMA:BeforestartingyourTMA,makesuretodoyourownresearchandensurethattheinformationneededisavailable.ThisisveryimportantsincetheTMAdoesnotonlyrelyoncoursematerialbutaswellonexternalresources.Todoso,youneedtousesearchengine,suchasgooglescholar,google,ask.com,yahoo.com,etc.tosearchforarticles,reportsthatdiscusssupplychaincollaboration,multiculturalcollaboration,challengesthatarisefrommulticulturalcollaboration.Youneedtointerviewatleastonememberfromthelargedepartmentstoreandtomakeaninitialcontactwithhimearlyintheresearchprocess,to


B325TMA–Spring2023–SB


Page2



ensurethatthepersonisindeedwillingtotalkwithyou.Youranswershouldnotbelistingofideasbutratheracriticaldiscussionofrelevantelements.Recommendationsareexpectedinthisregardattheendofyouranswer.

2. Hint:inyouressay,youneedtoconsiderthefollowing:

-

B325relevantcoursematerial:Ch5Theroleofgoalsinthemanagementofsupplychainnetworks,andCh13thechallengesthatarisefrommulticulturalcollaborationaswellasstrategiesusedtodealwiththesechallenges.

-ExplainrelevantB325coursematerialinacomprehensiveway;i.e.nolistingmakingsurethatexplanationisanintegratedpartoftheanswer.
-Clearlydefinethechosendepartmentstoreandtheinternationalsupplypartnerthatcollaboratewith.
-Criticallydiscussandevaluatethesupplychaincollaborationandexplaintheculturalchallengesthatarisefromthecollaborationbetweenthechosendepartmentstoreandinternationalsupplypartneraswellassuggestedstrategiestodealwiththesechallenges.
-Clearlywriteboththepartneringandthesupplychainmanagementstrategiesaretobesetbythedepartmentstoreascomponentsoftheoverallcollectivestrategy.
-Discussgoalcompatibilitybetweenthechosendepartmentstoreandinternationalsupplypartners,andsimultaneouslyarrangethenetwork’sharmoniouswork.
-Youhaveaplusorminus10%withregardtowordcount.
3. Answer Guidance
-Youranswershouldbewritteninanessayformat.

-

-

Intheintroduction,youmayreflectprovideadefinitionaboutsupplychaincollaborationandwhychosendepartmentstorecollaboratewiththeinternationalsupplypartner.Alsodefinethechosendepartmentstoreandtheinternationalsupplypartnerthatcollaboratewith.
Thebodytextcanbededicatedtoexplainingrelevanttheories.Thechallengesthatarisefromthecollaborationbetweenthechosendepartmentstoreandinternationalsupplypartnerbesidessuggestedstrategiestodealwiththesechallenges.

-Thepartneringandthesupplychainmanagementstrategiesaretobesetbythedepartmentstoreascomponentsoftheoverallcollectivestrategy.
-Thegoalcompatibilitybetweenthechosendepartmentstoreandinternationalsupplypartner,andsimultaneouslyarrangethenetwork’sharmoniouswork.

B325TMA–Spring2023–SBPage3




حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]





ARAB OPEN UNIVERSITY
FACULTY OF BUSINESS STUDIES
SYS280 – BUSINESS DYNAMICS: SYSTEMS THINKING AND MODELLING FOR A COMPLEX WORLD
TMA Spring 2022/2023
Please read these instructions carefully and contact your tutor if you require any further clarification. You should submit your completed assignment to your tutor to arrive no later than the cut-off Date (TBC).
Please use standard A4 size paper for submitting the hard copy of your TMA. Your name, personal identifier, course and assignment numbers must appear at the top of each sheet. A soft copy of your TMA must be uploaded to the university Moodle within the indicated cut-off date. The hard & soft copies must be identical. Please leave wide margins and space at the end of each sheet for tutor comments. It is better to use double spacing so that you can easily handwrite corrections to your drafts and tutors have space to include their feedback on the script. Start each question in the assignment on a new page. Any extended text should ideally be word-processed, but diagrams and accompanying notes may be hand drawn and handwritten on an A4 paper.
Completing and sending your assignments
When you have completed your TMA, you must fill in the assignment form (PT3), taking care to fill all information correctly including your personal identifier, course code, section & tutor, and assignment number. Each TMA and its PT3 form should be uploaded on the AOU branch Moodle within the cut-off date. Late submissions require approval from the branch course coordinator and will be subject to grade deductions. All assignments are treated in strict confidence.
If you feel that you are unable to meet the cut-off date of the TMA because of unusual circumstances, please contact your tutor as soon as possible to discuss a possible extension to the cut-off date.

Plagiarism
University Definitions of cheating and plagiarism
According to the Arab Open University By-laws, “the following acts represent cases of cheating and plagiarism:
● Verbatim copying of printed material and submitting them as part of TMAs without proper academic acknowledgement and documentation.
● Verbatim copying of material from the Internet, including tables and graphics.
● Copying other students’ notes or reports.
● Using paid or unpaid material prepared for the student by individuals or firms.
● Utilization of, or proceeding to utilize, contraband materials or devices in examinations.
Penalty on plagiarism:
The following is the standard plagiarism penalty applied across branches as per Article 11 of the university by-laws:
1. Awarding of zero for a TMA wherein more than 50% of the content is plagiarized.
2. Documentation of warning in student record.
3. Failure in the course to dismissal from the University.
All University programs are required to apply penalties that are consistent with the University by laws.
Examples of Plagiarism
Copying from a single or multiple source, this is where the student uses one or more of the following as the basis for the whole, or a good part, of the assignment:
1. Published or unpublished books, articles or reports
2. The Internet
3. The media (e.g.TV programs, radio programs or newspaper articles)
4. An essay from an essay bank
5. A piece of work previously submitted by another student
6. Copying from a text which is about to be submitted for the same assignment
General Mark’s deductions of 20% as follows
● PT3 Form (failure to use the PT3 completely filled) (deduct up to 5% marks)
● TMA Presentation and Structure, and word count (untidy, work way below or above the word count, no display of word count) (deduct up to 5% marks)
● Referencing and in-text citation (poor referencing and in-text citation, without plagiarism, (deduct up to 10% marks).
TMA instructions:
1- This is a group project TMA. Each team will consist of 3-4 students. This is a good opportunity for students to enhance their professional skills in terms of team working, communication, coordination, and time management skills. STUDENTS ARE NOT ALLOWED TO WORK INDIVIDUALLY.
2- Teams should be formed from members with the same tutor.
3- Each team should elect a TEAM LEADER.
4- Only the Team Leader should upload the TMA answer file on LMS before the cut-off date.
5- Your TMA consist of two part
a. A report submitted in word document through the LMS.
b. Power point presentation (should not be submitted through the LMS) it should be presented on the day of the presentation when announced.
6- You should conceptualise your case by utilising the steps discussed in Chapter 5 of your book.
7- Insure to use system language.

TMA QUESTIONS
Part A:
Q1.Detailed report that describe the problem and discuss how systems dynamic modelling can be used to improve our understanding of the ways in which an organization's performance is related to its internal structure and operations policies, including those of customers, competitors, and suppliers and then to use that understanding to design high leverage policies for success. To do so, you should conceptualise your case by utilising the steps discussed in Chapter 5 of your book (1500 words, 50 marks).

Q2. Draw the causal diagram for the above complexity and discuss the limitations of the causal diagram. Then explain who it might be used for policy analysis in your case. Support your answer with practical advices for the successful application (500 words, 10 marks).

Q3. Project Summary: You have to submit an overall summary for your tutor that summarise the full project and reflect your learning and applications used in SYS280. (MAX 500 words, 20 Marks):
Part B:
In a power point presentation: You have to submit an overall summary of the full report and reflect on your learning and applications of the SYS280 concepts (20 marks),
Your presentation must include the following
A. List of Names and roles of each member.
B. The summary of the report.
C. Challenges and difficulties faced in investigating and analysing the complexity.
D. Presentation for 6-10 minutes, where every single member must participate


Good Luck
END OF SYS280 TMA QUESTIONS-FALL2022-2023-V1



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






FacultyofBusinessStudies

ArabOpenUniversity


ManagingAcrossOrganizational&CulturalBoundariesB325


TutorMonitoringAssignment–Version2

Spring2023

QUESTION


B325TMA–Spring2023–SB


Page1




TMAintroduction
Thebasisoflocal,regional,andglobalcompetitionhaschanged.Nowadays,itisnolongeraracebetweenbusinessesinrelationtootherbusinesses,butratherthecompetitionbetweensupplychains.Therefore,companiesmovetomanagesupplychaincollaborationinwhichthereistheparticipationofmanyfirms,includingsuppliers,manufacturers,transporters,intermediaries,takinguponeorsomeworkphrase(suchasmarketing,logistic,finance…)andcollaboratingtoachievecompetitiveadvantage.Thus,supplychaincollaborationisbecomingessentialstrategyforanysuccessfulbusiness.Yetobstacles(suchasdistinctivelevelsgoals,differencesinculture……)tosupplychaincollaborationarepersistent.

QUESTION
ChoosealargeDEPARTMENTSTOREfromyourregionorlocalcontextthathasbestsupplychainpracticeswithinternationalpartnerandprepareareportforsupplychaincollaboration.Thereportneedstoincludeaclearintroductionofthechosenlargedepartmentstoreandanalysethechallengesfacingthedepartmentstoreregardingsupplychainmembers’differentgoalsandculturechallengesandsuggestactionstobetakentotacklethesechallenges.Itneedstoclearlyidentifythegoalsinsupplychainnetworksandcriticallyevaluatethechallengesthatarisefrommulticulturalcollaborationaswellasstrategiesusedtodealwiththesechallenges(wordlimit:2000words).

IMPORTANT GUIDELINES:
1- What you need to consider before you start your TMA:BeforestartingyourTMA,makesuretodoyourownresearchandensurethattheinformationneededisavailable.ThisisveryimportantsincetheTMAdoesnotonlyrelyoncoursematerialbutaswellonexternalresources.Todoso,youneedtousesearchengine,suchasgooglescholar,google,ask.com,yahoo.com,etc.tosearchforarticles,reportsthatdiscusssupplychaincollaboration,multiculturalcollaboration,challengesthatarisefrommulticulturalcollaboration.Youneedtointerviewatleastonememberfromthelargedepartmentstoreandtomakeaninitialcontactwithhimearlyintheresearchprocess,to


B325TMA–Spring2023–SB


Page2



ensurethatthepersonisindeedwillingtotalkwithyou.Youranswershouldnotbelistingofideasbutratheracriticaldiscussionofrelevantelements.Recommendationsareexpectedinthisregardattheendofyouranswer.

2. Hint:inyouressay,youneedtoconsiderthefollowing:

-

B325relevantcoursematerial:Ch5Theroleofgoalsinthemanagementofsupplychainnetworks,andCh13thechallengesthatarisefrommulticulturalcollaborationaswellasstrategiesusedtodealwiththesechallenges.

-ExplainrelevantB325coursematerialinacomprehensiveway;i.e.nolistingmakingsurethatexplanationisanintegratedpartoftheanswer.
-Clearlydefinethechosendepartmentstoreandtheinternationalsupplypartnerthatcollaboratewith.
-Criticallydiscussandevaluatethesupplychaincollaborationandexplaintheculturalchallengesthatarisefromthecollaborationbetweenthechosendepartmentstoreandinternationalsupplypartneraswellassuggestedstrategiestodealwiththesechallenges.
-Clearlywriteboththepartneringandthesupplychainmanagementstrategiesaretobesetbythedepartmentstoreascomponentsoftheoverallcollectivestrategy.
-Discussgoalcompatibilitybetweenthechosendepartmentstoreandinternationalsupplypartners,andsimultaneouslyarrangethenetwork’sharmoniouswork.
-Youhaveaplusorminus10%withregardtowordcount.
3. Answer Guidance
-Youranswershouldbewritteninanessayformat.

-

-

Intheintroduction,youmayreflectprovideadefinitionaboutsupplychaincollaborationandwhychosendepartmentstorecollaboratewiththeinternationalsupplypartner.Alsodefinethechosendepartmentstoreandtheinternationalsupplypartnerthatcollaboratewith.
Thebodytextcanbededicatedtoexplainingrelevanttheories.Thechallengesthatarisefromthecollaborationbetweenthechosendepartmentstoreandinternationalsupplypartnerbesidessuggestedstrategiestodealwiththesechallenges.

-Thepartneringandthesupplychainmanagementstrategiesaretobesetbythedepartmentstoreascomponentsoftheoverallcollectivestrategy.
-Thegoalcompatibilitybetweenthechosendepartmentstoreandinternationalsupplypartner,andsimultaneouslyarrangethenetwork’sharmoniouswork.

B325TMA–Spring2023–SBPage3



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]





ARABOPENUNIVERSITY
FACULTYOFBUSINESSSTUDIES
B327-CreatingFutures:SustainableEnterpriseandInnovation


TMA–Version:A–SPRING2022-23
Cut-off Date:AsannouncedonLMS

1. StudentsneedtoreadtheTMAinstructionscarefullyandcontacttheirtutorsiffurtherclarificationisneeded.
2. TMAanswerfilesshouldbesubmittedtoLMSonorbeforethecut-offdate.Latesubmissionsarepenalizedwithmarksdeductionsasperuniversityregulations.
3. TMAanswerfileshouldbeinWORDform.Otherformatsare not acceptedandmightresult-indisqualifyingtheworksubmitted.
4. TMAPT3formshouldbecompletedwithallinformationsuchas:studentnameandIDnumber,sectionnumber,andtutor'sname.ThePT3TMAformshouldbeinsertedastheFIRSTpageoftheTMAanswerfile.

TheArabOpenUniversitydefinitionsofplagiarism
AccordingtotheArabOpenUniversityregulations,thefollowingactsrepresentcasesofplagiarism:
• Verbatim(exact)copyingofprintedmaterialandsubmittingthemaspartofTMAswithoutproperacademicacknowledgementanddocumentation.
• Verbatim(exact)copyingofmaterialfromtheInternet,includingtablesandgraphics.
• Copyingotherstudents’notesorreports.
• CopyingpreviousworksubmittedtoanyAOUbranch.
• Usingpaidorunpaidmaterialpreparedforthestudentbyindividualsorfirms.

ThefollowingisthestandardplagiarismpenaltyappliedacrossAOUbranchesasperArticle11oftheuniversityregulations:
• AwardingofzeroforaTMAwhereinmorethan40%ofthecontentisplagiarized.
• Documentationofwarninginthestudentrecord.
• Failureinthecoursetodismissalfromtheuniversityforrepeatedplagiarism.
AllUniversityprogrammesarerequiredtoapplypenaltiesthatareconsistentwiththeUniversityregulations.


1of3




1-THISISAGROUPPROJECTTMA.Eachteamshould consist of 3-4 students.Thisisagoodopportunityforstudentstoenhancetheirprofessionalskillsintermsofteamworking,communications,coordination,andtimemanagementskills.
2-Teamsshouldbeformedfromstudentsin the same section.
3-EachteamshouldselectaTEAM LEADER.TheteamleaderisresponsibleforcontactingtheirtutortogetApprovalfortheTMAtopictoavoidduplication.
4-Only the Team LeadershoulduploadtheTMAanswerfileonLMSbeforethecut-offdate.5-75%oftheTMAmarkisawardedfortheTMAreport(15marks),while25%(5marks)are
INDIVIDUALLYawardedbasedonapresentationoftheTMAreportbyall team members.

Sustainabilityhasbecomeoneofthemostimportantconcernsformodernenterprises.ThefocusofthisTMAistoselectanexampleofasustainableenterpriseanddiscussthefactorsthathadledtoitssuccessalongwiththechallengesthatitfacesinadoptingsustainability.Studentsneedtocriticallyexamine,analyse,andevaluatetheenterprisesustainabilitypracticeswithreferencetothetheoriesdiscussedincoursematerialasthebasisforanswer.StudentsneedNOTtobroadlytellstoriesabouttheenterprise.Rather,anacademic,scientificanalysisisexpectedastheoutcomeofthisTMAassignment.

Write a (2000 word) report tackling the following 5 points:

1. Namethesustainableenterpriseandbrieflydescribeitsproductsandactivities.(10marks)
2. Whatdoesitmeantobesustainable?Whyisyourchosenenterpriseconsideredsustainable?(20marks)
3. BasedonSacchettiandTortia(2016)continuum,discusstheenterpriseownershipstructure,andhowdoesitaffecttheenterprisegovernanceandsocietalimpacts?(25marks)
4. Discusshowdoestheenterprisemaintainitsinput-outputrulestoachieveEnvironmentalSustainability(ES)?WhichONEfactoristheMOSTinfluentialinadoptingESandenvironmentallyfriendlyinnovations?Justifyyourselection.(25marks)
5. Describethe4componentsoftheenterprise’sSustainableBusinessModel(SMB).(20marks)

2of3



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]









حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






ArabOpenUniversity
FacultyofBusinessStudies
BUS310:StrategicManagement:CreatingCompetitiveAdvantages
Spring2022-2023
TeamWork-Tutor-MarkedAssignment,
KSA- Branch
(Duedate:TobeassignedbyVPAA)
1.TMA Topic overview: Strategic Analysis for an Institution/Organization
Theessenceofstrategicmanagementisthestudyofwhysomefirmsoutperformothers.Managersneedtoknowhowtocompeteandsecureacompetitiveadvantageoveralengthyperiodoftimeandtopracticeseveralstrategictoolsandmodelsareused.Howusefulthesestrategictoolsandmodelsinhelpingdecision-makersatorganizationstomakeabetterdecisionisanoteworthyquestionforinvestigation.
2.TMA Requirements/Components
 ThisTMAisateambasedassignmentanditaccountsfor20%ofthetotalgradeassignedtothecourse.Eachteamshouldconsistbetween2-3students.TMA paper should beuploaded to the LMS by the team leader only .Thisisaveryimportantrequirementinordertoavoidsimilarities.ThenamesofalltheteammembersshouldbewrittenonthePt#3form,includingthenameoftheteamleader.AllteammemberswillreceivethesamemarkontheTMA.ItishighlyimportantthatstudentsarerequiredtousethePt#3formprovidedontheLMSforthisspecificTMA.
 Submittedworkcopiedfromothersisnotacceptable.Submittingworkthathasbeendonebysomeoneelseandpersistentborrowingofotherpeople’sworkwithoutcitationareobviousinstancesofplagiarismandareregardedascheating.Ifacaseofplagiarismisproven,thisisaseriousoffenceandthedisciplinaryprocedureswillbefollowed,asdescribedundertheExaminationPolicyoftheAOU.Casesofplagiarismwillreceiveamarkof“Zero ”ontheassignment.PleaserefertoAOUplagiarismpolicy.Copyandpaste-plagiarizedworkwillbedetectedbyUrkundandheavilypenalized.Similarityshouldnotexceed30%.TMAmustbewritteninESSAY(discussion)format,bulletpointsandnumberingnotallowed.Youshouldpresentawell-structuredandorganizedpieceofworkthatisofyourown.
 Wordcountshouldbeexactwith10%(More/less)tolerance.
 YoumustacknowledgeallsourcesofinformationusingHarvardStyleReferencing(In-textreferencingpluslistofreferencesattheend).Minimumof3referencesarerequired.TMAMUSTincludeE-libraryandcoursematerials.Wikipediaisnotrecommendedasareference.
N.B-1:Gradesdeductionwillbeimplementedifyoudidnotcomplywiththefollowingcriteria:Properreferencing(Harvardstylereferencing)-Deductionscouldbeupto5grades.Essayformat/Presentation(includingPt#3form)-Deductionscouldbeupto5grades.Adherencetospecifiedwordcount–Deductionscouldbeupto5grades.
UseoftheE-library/Externalresources–Deductionscouldbeupto5grades.
N.B-2:TMAismeanttorespondtorecommendationsgivenbyEEtoencourageanddevelopgreatercriticalanalyticalskillsespeciallyatlevel6,byencouragingyouasstudentstoreadmorewidelyandtoreflectontheapplicationofthecoursetheoriesandconcepts

Page1


3.Analyzing an organization
-Itisadvisabletousepubliclyavailableinformationtobeginyouranalysis:theorganization'sWebsiteisoftenthebeststartingpoint.Remember,however,thatyouareusingtheWebsiteasasourceofdatafortheanalysis;donotsimplycopymaterialofftheWebsite.Yourassignmentisananalysis,notadata-dump.
(N.B.YoushouldarrangewithyourtutorinordertoverifythatnootherteamhadselectedthesameorganizationfortheTMA).
-Youwillneedtointerviewatleastonememberoftheorganization(eitheracurrentmemberoronewhohasrecentlyleftit).Itcanbeveryusefultomakeaninitialcontactwithyourinformantearlyintheresearchprocess,toensurethatthepersonisindeedwillingtotalkwithyou.Youwillfindtheinformantmostuseful,however,afteryouhavedonethepreliminaryworkwiththepubliclyavailablematerials.
-ThepurposeofthisTMAistodevelopyourabilitytousetheconceptualframeworksandtoolsfromtheBUS310coursesincethisTMAismeanttoassessyourabilityinunderstanding,andapplicationofthecoursematerialsandideasaswellastoyourreflectionandcriticalthinking.Itisalsointendedtotestyourabilitytoarguerelevantlyandtojustifyapointofviewbesides,constructing,defendingandevaluatinganargument,usingrelevantevidenceandgivingreasonsforconclusions.

B2C E-Commerce

ThedevelopmentofB2Cecommercehasbeenamajordriverofeconomicgrowthandinnovationoverthepasttwodecades.B2Cecommercereferstothebuyingandsellingofgoodsandservicesbetweenbusinessesandconsumers.Thistypeofe-commercehasrevolutionizedthewaybusinessesandconsumersinteract,allowingforfaster,moreefficienttransactionsandagreatervarietyofproductsandservices.ThedevelopmentofB2Cecommercehasbeendrivenbyanumberoffactors,includingtheriseoftheinternet,theemergenceofmobiletechnology,andtheincreasingavailabilityofonlinepaymentsystems.Theinternethasallowedbusinessestoreachamuchlargercustomerbase,whilemobiletechnologyhasenabledcustomerstoshopfromanywhereatanytime.Onlinepaymentsystemshavemadeiteasierforcustomerstomakepurchases,andhavealsoallowedbusinessestoacceptpaymentsfromcustomersindifferentcountries.ThedevelopmentofB2Cecommercehasalsobeendrivenbytheemergenceofnewbusinessmodels,suchassubscription-basedservices,marketplaceplatforms,anddigitalmarketplaces.Thesenewbusinessmodelshaveallowedbusinessestooffercustomersmoreoptionsandbetterprices,whilealsoprovidingthemwithmorecontrolovertheirpurchases.ThedevelopmentofB2Cecommercehasalsobeendrivenbytheemergenceofnewtechnologies,suchasartificialintelligence,machinelearning,andblockchain.Thesetechnologieshaveenabledbusinessestoautomateprocesses,improvecustomerservice,andprovidecustomerswithmorepersonalizedexperiences.Overall,thedevelopmentofB2Cecommercehasbeenamajordriverofeconomicgrowthandinnovationoverthepasttwodecades.Ithasallowedbusinessestoreachamuchlargercustomerbase,whilealsoprovidingcustomerswithmoreoptionsandbetterprices.Ithasalsoenabledbusinessestoautomateprocesses,improvecustomerservice,andprovidecustomerswithmorepersonalizedexperiences.Finally,ithasallowedcustomerstoshopfromanywhereatanytimeandhasmadeiteasierforthemtomakepurchases.

Page2



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






M109:.NetProgramming
Tutor-MarkedAssignment(Spring2022-2023)
Cut-OffDate:BasedonthePublishedDeadline.TotalMarks:60marksturnedto15marks

Contents
WarningsandDeclaration…………………………………….……………………………….........1
Problem#1……………….………………………………….………………………………....…..3Problem#2…………………………………………………………………………………..…..…..4
PlagiarismWarning:
AsperAOUrulesandregulations,allstudentsarerequiredtosubmittheirownTMAworkandavoidplagiarism.TheAOUhasimplementedsophisticatedtechniquesforplagiarismdetection.Youmustprovideallreferencesincaseyouuseandquoteanotherperson'sworkinyourTMA.YouwillbepenalizedforanyactofplagiarismaspertheAOU'srulesandregulations.
DeclarationofNoPlagiarismbyStudent(tobesignedandsubmittedbystudentwithTMAwork):
IherebydeclarethatthissubmittedTMAworkisaresultofmyowneffortsandIhavenotplagiarizedanyotherperson'swork.IhaveprovidedallreferencesofinformationthatIhaveusedandquotedinmyTMAwork.
NameofStudent:……………………………..
Signature:…………………………………………...
Date:…………………………………………………

Page1of6



ApplythefollowingprocedureforsolvingALLtheTMAproblems
A. Readandanalyzetheproblemstatement.
B. Formulatethealgorithmusingpseudocodeandassumeanyrequiredmisseddatareasonably.
C. WriteaC#application.
D. Writeacommentforeachlineofcodeusingyourownwords
E. Test,debugandexecutetheC#application.
F. CopyandpasteyourcodefromVisualStudiototheAnswerBooklet(Don’tputyourcodeasascreenshot).
G. ProvideScreenshotsforboththeinputandoutputofALLcasesofeachproblem.DONOTsubmitsampleofscreenshots.
H. YourTMAAnswerBookletshouldbestructuredasfollows:
1.Problem # 1 Shapes Tutorial Problem:
1.1Algorithmpseudocode
1.2Completeproblem’sapplicationcode(Copied)
1.3ScreenshotsofbothinputandoutputforALLcasesoftheproblem2.Problem # 2 Restaurant Reservation Problem:
2.1Algorithmpseudocode
2.2Completeproblem’sapplicationcode(Copied)
2.3ScreenshotsofbothinputandoutputforALLcasesoftheproblem


DistributionofMarks
Requirement Mark
Algorithmpseudocode 20%
Correctcalculationsformulas 20%
Testing 20%
Validreportformat 5%
Comments 15%
Runningapplication 20%

Page2of6



Problem # 1: Shapes Tutorial (35 marks)

GiventhefollowingbriefproblemdescriptionandthesampleofI/Oscreens,developasimplemathematicaltutorialforcalculatingtheperimeterandareaofvariousshapes.

Atthebeginning,theuserselectsthemaintypeoftheshapeandthentheprogramdirectshimtoselectoneofthesubtypesofthisshape.Next,theuserisrequestedtoenterthetypeofcalculationhewants(eitherperimeterorarea).Theapplicationshowsthegeneralformulaoftherequiredcalculationandthenprintsthecalculatedresult.YoushouldconsiderthecalculationofperimeterandareaforALLthemainshapesandtheirsubtypes.

Considerthefollowingpoints:-
1-Theinputvariesaccordingtothetypeoftheshapeandtherequiredcalculation.2-Thereisnosubtypeofthe“Circle”mainshape.
3-Asatutorial,theapplicationshouldstatethegeneralformulafirst,thenshowtheoutput.

Screen #1

. حل واجب tm112** 00966562053739 < > حلول,واجبات,الجامعة,العربية,المفتوحة
#حل b326 واجب tm112 00966562053739 واجبات tm112الجامعة العربية المفتوحة
b326: 00966562053739 واجب tm112, واجبات الجامعة العربية المفتوحة
tm112TMA Answers 00966562053739 حل واجب tm112
حل , tm112واجب , 00966562053739 < حلول واجبات الجامعـة العربية المفتوحة
حل واجب tm112b325 & 00966562053739 @ حلول واجبات الجامعة العربية المفتوحة
حل واجب b325 b325 $ 00966562053739 واجب b326 لواجبات الجامعة العربية المفتوحة
حل الواجب 00966562053739 واجبات tm112الجامعة العربية المفتوحة ،،
00966562053739 حلول واجبات الجامعه العربية المفتوحة
حل واجب tm112>>> 00966562053739 << > واجبات الجامعة العربية المفتوحة
M10900966562053739 TMA حل واجبات M109الجامعة العربية المفتوحة
M109~ حل واجب b326 ** 00966562053739 ~ ~ حلول,واجبات,الجامعة,العربية,المفتوحة
# حل b325 واجب b326 00966562053739 واجبات M109الجامعة العربية المفتوحة
b325 00966562053739 واجب M109, واجبات الجامعة العربية المفتوحة
حل واجب b325 (00966562053739 ) M109TMA Answers 00966562053739 واجب b325 00966562053739
حل b325 واجب , M10900966562053739 ~ حلول واجبات الجامعـة العربية المفتوحة
حل واجب M10900966562053739 > لحلول الواجبات الجامعة العربية المفتوحة
واجب b325 00966562053739 حل واجب M109حل واجبات الجامعة
حل واجبات الإمتياز M109<< 00966562053739 ,,,, حلول واجبات b326
حل,واجبات,الجامعة,العربية, 00966562053739 b326,المفتوحة, حل واجب b325 حلول واجبات الجامعة العربية المفتوحة
b326 00966562053739 TMA حل واجبات b326 الجامعة العربية المفتوحة
~ حل واجب M109** 00966562053739 ~ ~ حلول,واجبات,الجامعة,العربية,المفتوحة
#حل_واجب 00966562053739 حل واجبات b325 الجامعة العربية المفتوحة
M109: 00966562053739 حل واجب M109, واجبات الجامعة العربية المفتوحة
M109TMA Answers: حل واجب 00966562053739
حل , واجب , 00966562053739 ~ حلول واجبات الجامعـة العربية المفتوحة
حل واجب M109? 00966562053739 > لحلول الواجبات الجامعة العربية المفتوحة
b325 00966562053739 حل واجب M109الجامعة
حل واجبات الإمتياز M109<< 00966562053739 حلول واجبات M109
حل,واجبات,الجامعة,العربية, 00966562053739 M109,المفتوحة, حل واجب M109الجامعة العربية المفتوحة

حل واجبات جروب الإمتياز 00966562053739 M109

حل واجبات الجامعة العربية المفتوحة 00966562053739 M109

Page3of6



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






ARABOPENUNIVERSITY
FACULTYOFBUSINESSSTUDIES
SYS210–BusinessDrivenTechnology
Spring2022–2023
TMA-Questions
Pleasereadtheseinstructionscarefullyandcontactyourtutorifyourequireanyfurtherclarifications.Youshouldsubmityourcompletedassignmenttoyourtutortoarrivenolaterthanthecut-offDate(TBC).
AsoftcopyofyourTMAmustbeuploadedtotheuniversitymoodlewithintheindicatedcut-offdate.Pleaseleavewidemarginsandspaceattheendofeachsheetfortutorcomments.Itisbettertousedoublespacingsothatyoucaneasilyhandwritecorrectionstoyourdraftsandtutorshavespacetoincludetheirfeedbackonthescript.Starteachquestionintheassignmentonanewpage.Anyextendedtextshouldideallybeword-processed,but,diagramsandaccompanyingnotesmaybehanddrawnandhandwrittenandonanA4paper.
Completingandsendingyourassignments
WhenyouhavecompletedyourTMA,youmustfillintheassignmentform(PT3),takingcaretofillallinformationcorrectlyincludingyourpersonalidentifier,coursecode,section&tutor,andassignmentnumber.EachTMAanditsPT3formshouldbeuploadedontheAOUbranchmoodlewithinthecut-offdate.Latesubmissionsrequireapprovalfromthebranchcoursecoordinatorandwillbesubjecttogradedeductions.Allassignmentsaretreatedinstrictconfidence.
Ifyoufeelthatyouareunabletomeetthecut-offdateoftheTMAbecauseofunusualcircumstances,pleasecontactyourtutorassoonaspossibletodiscussapossibleextensiontothecut-offdate.
Plagiarism
UniversityDefinitionsofcheatingandplagiarism
AccordingtotheArabOpenUniversityBy-laws,

1


“Thefollowingactsrepresentcasesofcheatingandplagiarism:
• VerbatimcopyingofprintedmaterialandsubmittingthemaspartofTMAswithoutproperacademicacknowledgementanddocumentation.
• VerbatimcopyingofmaterialfromtheInternet,includingtablesandgraphics.
• Copyingotherstudents’notesorreports.
• Usingpaidorunpaidmaterialpreparedforthestudentbyindividualsorfirms.
• Utilizationof,orproceedingtoutilize,contrabandmaterialsordevicesinexaminations.Penaltyonplagiarism:

ThefollowingisthestandardplagiarismpenaltyappliedacrossbranchesasperArticle11oftheuniversityby-laws:
1) AwardingofzeroforaTMAwhereinmorethan50%ofthecontentisplagiarized.
2) Documentationofwarninginstudentrecord.
3) FailureinthecoursetodismissalfromtheUniversity.

AllUniversityprogramsarerequiredtoapplypenaltiesthatareconsistentwiththeUniversitybylaws.
ExamplesofPlagiarism
Copyingfromasingleormultiplesource,thisiswherethestudentusesoneormoreofthefollowingasthebasisforthewhole,oragoodpart,oftheassignment:
1. Publishedorunpublishedbooks,articlesorreports
2. TheInternet
3. Themedia(e.g.TVprograms,radioprogramsornewspaperarticles)
4. Anessayfromanessaybank
5. Apieceofworkpreviouslysubmittedbyanotherstudent
6. Copyingfromatextwhichisabouttobesubmittedforthesameassignment


2



حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]






FacultyofComputerStudies
TM112:IntroductiontoComputingandInformation
Technology2

Spring2022/2023

Tutor-MarkedAssignment

Cut-OffDate:TBA

TotalMarks:30

PlagiarismWarning:

AsperAOUrulesandregulations,allstudentsarerequiredtosubmittheirownTMAworkandavoidplagiarism.TheAOUhasimplementedsophisticatedtechniquesforplagiarismdetection.Youmustprovideallreferencesincaseyouuseandquoteanotherperson'sworkinyourTMA.YouwillbepenalizedforanyactofplagiarismaspertheAOU'srulesandregulations.

DeclarationofNoPlagiarismbyStudent(tobesignedandsubmittedbystudentwithTMAwork):

IherebydeclarethatthissubmittedTMAworkisaresultofmyowneffortsandIhavenotplagiarizedanyotherperson'swork.IhaveprovidedallreferencesofinformationthatIhaveusedandquotedinmyTMAwork.

NameofStudent:………………………………..

Signature:…………………………………………...

Date:……………………………………………………






Question 1:(10 marks)

SomesaythatSecurityandPrivacyareMutuallyExclusive,whileotherssaytheyarenot.Manytoolshavebeenembeddedinourcomputerandmobilephonesappstoensureprivacyandsecurity,preventinginformationfromfallingintothewronghands.Inthisregard,youareaskedtodosomeresearch,andwriteareportthatanswersthefollowingpoints:

-WhatistheClipperchip,andwhatwasitintendedtodo?Discuss,andnamethetwoseparatekeysthataClipperdevicecontains.
-WhatistheSkipjackalgorithm?Discussbrieflyhowencryptionanddecryptionworkusingthisalgorithm.

Report Writing:

Youshouldfollowthefollowingguidelineswhilewritingyourreport:

 Yourreportshouldbebetween500and600wordsinlength,andyoushoulduseyourownwords.
 Ensurethatyourreporthasanappropriatestructureandwritingstyle.
 Youshouldincludethereferences(atleasttwo).

Question 2:(10 marks)

TurtleGraphicsisaPythonfeaturelikeadrawingboard,whichletsuscommandaturtletodrawalloverit!Wecanusefunctionslikeforward(…)andright(…)whichcanmovetheturtlearound.Commonlyusedturtlemethodsarefoundinthepostedpdffile“turtle—Turtlegraphics—Python3.7.1rc1documentation”
Tomakeuseoftheturtlemethodsandfunctionalities,weneedtoimportturtle.“turtle”comespackedwiththestandardPythonpackageandneednotbeinstalledexternally.Theroadmapforexecutingaturtleprogramfollows3steps:
1. Importtheturtlemodule
2. Createaturtletocontrol.
3. Drawaroundusingtheturtlemethods.

Problem:
Ingeometry,ahexagonisasixpolygon.Eachinternalangleis120degrees(outeris60)
. حل واجب tm112** 00966562053739 < > حلول,واجبات,الجامعة,العربية,المفتوحة
#حل b326 واجب tm112 00966562053739 واجبات tm112الجامعة العربية المفتوحة
b326: 00966562053739 واجب tm112, واجبات الجامعة العربية المفتوحة
tm112TMA Answers 00966562053739 حل واجب tm112
حل , tm112واجب , 00966562053739 < حلول واجبات الجامعـة العربية المفتوحة
حل واجب tm112b325 & 00966562053739 @ حلول واجبات الجامعة العربية المفتوحة
حل واجب b325 b325 $ 00966562053739 واجب b326 لواجبات الجامعة العربية المفتوحة
حل الواجب 00966562053739 واجبات tm112الجامعة العربية المفتوحة ،،
00966562053739 حلول واجبات الجامعه العربية المفتوحة
حل واجب tm112>>> 00966562053739 << > واجبات الجامعة العربية المفتوحة
b326 00966562053739 TMA حل واجبات b326 الجامعة العربية المفتوحة
tm112~ حل واجب b326 ** 00966562053739 ~ ~ حلول,واجبات,الجامعة,العربية,المفتوحة
# حل b325 واجب b326 00966562053739 واجبات b325 الجامعة العربية المفتوحة
b325 00966562053739 واجب tm112, واجبات الجامعة العربية المفتوحة
حل واجب b325 (00966562053739 ) tm112TMA Answers 00966562053739 واجب b325 00966562053739
حل b325 واجب , tm112 00966562053739 ~ حلول واجبات الجامعـة العربية المفتوحة
حل واجب b326 00966562053739 > لحلول الواجبات الجامعة العربية المفتوحة
واجب b325 00966562053739 حل واجب tm112حل واجبات الجامعة
حل واجبات الإمتياز tm112<< 00966562053739 ,,,, حلول واجبات b326
حل,واجبات,الجامعة,العربية, 00966562053739 b326,المفتوحة, حل واجب b325 حلول واجبات الجامعة العربية المفتوحة
b326 00966562053739 TMA حل واجبات b326 الجامعة العربية المفتوحة
~ حل واجب B326** 00966562053739 ~ ~ حلول,واجبات,الجامعة,العربية,المفتوحة
#حل_واجب 00966562053739 حل واجبات b325 الجامعة العربية المفتوحة
B326: 00966562053739 حل واجب tm112, واجبات الجامعة العربية المفتوحة
B326TMA Answers: حل واجب 00966562053739
حل , واجب , 00966562053739 ~ حلول واجبات الجامعـة العربية المفتوحة
حل واجب B326? 00966562053739 > لحلول الواجبات الجامعة العربية المفتوحة
b325 00966562053739 حل واجب tm112واجبات الجامعة
حل واجبات الإمتياز tm112<< 00966562053739 حلول واجبات tm112
حل,واجبات,الجامعة,العربية, 00966562053739 tm112,المفتوحة, حل واجب tm112واجبات الجامعة العربية المفتوحة

حل واجبات جروب الإمتياز 00966562053739 tm112

حل واجبات الجامعة العربية المفتوحة 00966562053739 tm112




حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]
 
إنضم
30 أكتوبر 2022
المشاركات
87
مستوى التفاعل
0
النقاط
6
حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]








MT131 : Discrete Mathematics
Tutor Marked Assignment

Cut-Off Date: April --, 2023 Total Marks: 30
Contents
Feedback form ……….……………..…………..…………………….…...….. 2
Question 1 ……………………..………………………………………..……… 3
Question 2 ……………………………..………………..……………………… 4
Question 3 ………………………………..………………..…………………… 5
Question 4 ………………..……………………………………..……………… 6
Plagiarism Warning:
As per AOU rules and regulations, all students are required to submit their own TMA work and avoid plagiarism. The AOU has implemented sophisticated techniques for plagiarism detection. You must provide all references in case you use and quote another person's work in your TMA. You will be penalized for any act of plagiarism as per the AOU's rules and regulations.
Declaration of No Plagiarism by Student (to be signed and submitted by students with TMA work):
I hereby declare that this submitted TMA work is a result of my own efforts and I have not plagiarized any other person's work. I have provided all references of information that I have used and quoted in my TMA work.

Student Name : _____________________
Signature : _________________
Date : ___________

MT131 TMA Feedback Form

[A] Student Component

Student Name : ____________________
Student Number : ____________
Group Number : _______

Tutor Component

Comments Weight Mark
Q_1 6
Q_2 8
Q_3 8
Q_4 8
30



General Comments:




Tutor name:

The TMA covers only chapters 1, 2, 4 and 9 and consists of four questions for a total of 30 marks. Please solve each question in the space provided. You should give the details of your solutions and not just the final results.

Q−1: [3+1+2 marks]
In the following statement, find the inverse, convers and contrapositive:
(A positive integer is a prime only if it has no divisor other than 1 and itself.)
Determine whether the following is True or False:
∀x( “2x + 3 ≥ x + 4”) ; Where the domain is the set of integers.
Using the truth table determine whether the following proposition is a tautology:
[(p∨q)∧(p→¬r)∧r]→q.



Q−2: [4+4 marks]
Suppose f:R⟶Z, where f(x)=⌊x+1/2⌋
Graph the function f(x).
If A={x:1≤x≤3}, find f(A).
Find f^(-1) ({0})
Find f^(-1) ({-1,0,1})
Let the functions f,g and h be defined as follows:
f:R→R ;f(x)=4x-3
g:R→R ;g(x)=x^2+1
h:R→R ;h(x)={1 if x≥0 0 if x<0
Find the rules for the following functions:
fοg
gοf
fοh
hοf



















Q−3: [4+4 marks]
Find the set of solutions of each of the linear congruence:
8x ≡ 12 (mod 28).
7x≡1 (mod 9).

Hashing Function is used to assign a memory location for the records in the computer (For example to assign a memory location for the student ID number).
The function used to assign locations is given by: h(k)=k mod m
When m=50 memory locations, find the location assigned to the following number:

64212848
37149212
107405723






Q−4: [4+4 marks]
Let R be the relation on the set A={1,2,3,4} defined by
R={(x,y)/x+3y≤12}.
Find the matrix representing R∘R.
Suppose that the relation R is defined on the set Z where aRb means:
b= a^r , for some positive integer.
Show that R is a partial ordering relation.





حل واجبات الجامعة العربية المفتوحة
حل واجبات الجامعه العربية المفتوحه مع الشرح
لجميع فروع الجامعة ولجميع التخصصات ولجميع المواد

حلول نموذجية مضمونة وغير مكررة - قسم خاص للتربية

KSA-Kuwait - Bahrain -Oman - Jordon -Lebanon -Egypt-Sudan

الكويت البحرين عمان الأردن لبنان مصر البحرين حائل الرياض الدمام جدة المدينة المنورة الاحساء
(.turnitin./ ) فحص التشابه وفقا لنظام الجامعة عن طريق موقع كشف التشابه

اتصل : - 00966562053739

واتس اب: 00966562053739

ايميل : [email protected]


حل واجب الجامعة العربية المفتوحة


حل واجبات الجامعة العربية المفتوحة 00966562053739
ايميل : [email protected]

واتس اب: OO966.5.6.2.0.5.3.7.3.9

[/SIZE]